|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G05940 | AT | Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr2:2287514-2289270 REVERSE LENGTH=462 | SoyBase | E_val: 4.00E-35 | ISS |
| GO:0000165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: MAPK cascade | SoyBase | N/A | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0006499 | GO-bp | Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0007154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell communication | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009611 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to wounding | SoyBase | N/A | ISS |
| GO:0009625 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to insect | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009697 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009863 | GO-bp | Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009867 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009963 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0016036 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation | SoyBase | N/A | ISS |
| GO:0019375 | GO-bp | Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process | SoyBase | N/A | ISS |
| GO:0030968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response | SoyBase | N/A | ISS |
| GO:0031348 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response | SoyBase | N/A | ISS |
| GO:0042538 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response | SoyBase | N/A | ISS |
| GO:0042631 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation | SoyBase | N/A | ISS |
| GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
| GO:0045087 | GO-bp | Annotation by Michelle Graham. GO Biological Process: innate immune response | SoyBase | N/A | ISS |
| GO:0050832 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to fungus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0004674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| PTHR24420 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24420:SF685 | Panther | JGI | ISS | ||
| PF00069 | PFAM | Protein kinase domain | JGI | ISS | |
| UniRef100_G7I8Y4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase 2B n=1 Tax=Medicago truncatula RepID=G7I8Y4_MEDTR | SoyBase | E_val: 8.00E-36 | ISS |
| UniRef100_I1MHG2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MHG2_SOYBN | SoyBase | E_val: 9.00E-40 | ISS |
|
Glyma15g27500 not represented in the dataset |
Glyma15g27500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g210200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g27500.1 sequence type=CDS gene model=Glyma15g27500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGACGGTGACTGGTGCAACCGGTGGACGTGGAGGGTTGGAAGCTGCAATGGGGCTAAGGTTTCAAACCAAAAACATGAGACGTGAGACTAATAATAGTAAACTGAAAGTGGTCTGTGTGATCTTCAAATTTCCTATGTATCACAGGGTTTTAGTATACGAATATTTACCAACAGGAAGCTTGGAGAATCAATTATTTAGAAGATTCTCGGCATCACTTTCATGGTCAATGAGAATGAAAATTGTTGTTGGAGCTGTGAAAGGTTTAGCATTTCTTCATGAAGCTGAGAAGCCAGTCATCTATAGAGATTTCAAAGCTTCCAAAATCTTGTTAGGCTCTAAGTTCATAACACCTATCTATATGTGTTTATTTGATTTAATATTTTATAAGGGGTTTATGGGTACACACGGCTACGCAGCTCTAGAATATATCATTACTGGTAACCTTACAACTTTATATTTCCCATCAATCCAGTTTCATCTAATAATAATAATAGCTAAAGATTTAAAAGTCATTTTTTATTATAAAAAAGTGTAA
>Glyma15g27500.1 sequence type=predicted peptide gene model=Glyma15g27500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MTVTGATGGRGGLEAAMGLRFQTKNMRRETNNSKLKVVCVIFKFPMYHRVLVYEYLPTGSLENQLFRRFSASLSWSMRMKIVVGAVKGLAFLHEAEKPVIYRDFKASKILLGSKFITPIYMCLFDLIFYKGFMGTHGYAALEYIITGNLTTLYFPSIQFHLIIIIAKDLKVIFYYKKV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||