SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g25450

Feature Type:gene_model
Chromosome:Gm15
Start:26817878
stop:26818650
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g25450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08530AT Annotation by Michelle Graham. TAIR10: Clathrin, heavy chain | chr3:2587171-2595411 REVERSE LENGTH=1703 SoyBaseE_val: 5.00E-44ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006897GO-bp Annotation by Michelle Graham. GO Biological Process: endocytosis SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030130GO-cc Annotation by Michelle Graham. GO Cellular Compartment: clathrin coat of trans-Golgi network vesicle SoyBaseN/AISS
GO:0030132GO-cc Annotation by Michelle Graham. GO Cellular Compartment: clathrin coat of coated pit SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10292Panther CLATHRIN HEAVY CHAIN JGI ISS
PTHR10292:SF1Panther CLATHRIN HEAVY CHAIN JGI ISS
PF01394PFAM Clathrin propeller repeat JGI ISS
UniRef100_G7JBT5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Clathrin heavy chain n=1 Tax=Medicago truncatula RepID=G7JBT5_MEDTR SoyBaseE_val: 1.00E-44ISS
UniRef100_I1MI28UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MI28_SOYBN SoyBaseE_val: 3.00E-62ISS

Expression Patterns of Glyma15g25450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g25450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g208000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g25450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g25450
>Glyma15g25450.1   sequence type=CDS   gene model=Glyma15g25450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGCTGCCAACGCTCCGATCGCCATGAGAGAAGCTCTCACCTTGCCAAGCATTGACATAAATCCGCAGTTCATCACTTTCACGCATGTGACGATGGAGTCTGATAAGTATATATGCGTTCGAGAAACGGCTCCGCAGAATAGTGTGGTTATCATTGATATGAACATGCCGAATCAGCCTTTGAGGAGGCCTATTACGGCAGATTCCGCTCTTATGAATCCAAATTCTAGAATCCTTGCTTTGAAAGGTTGGCTACTATTCCGTTGTATTCTTCTCATGAACTTGTGA
Predicted protein sequences of Glyma15g25450
>Glyma15g25450.1   sequence type=predicted peptide   gene model=Glyma15g25450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAANAPIAMREALTLPSIDINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQPLRRPITADSALMNPNSRILALKGWLLFRCILLMNL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo