|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G08530 | AT | Annotation by Michelle Graham. TAIR10: Clathrin, heavy chain | chr3:2587171-2595411 REVERSE LENGTH=1703 | SoyBase | E_val: 5.00E-44 | ISS |
| GO:0006886 | GO-bp | Annotation by Michelle Graham. GO Biological Process: intracellular protein transport | SoyBase | N/A | ISS |
| GO:0006897 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endocytosis | SoyBase | N/A | ISS |
| GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0030130 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: clathrin coat of trans-Golgi network vesicle | SoyBase | N/A | ISS |
| GO:0030132 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: clathrin coat of coated pit | SoyBase | N/A | ISS |
| GO:0005198 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural molecule activity | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR10292 | Panther | CLATHRIN HEAVY CHAIN | JGI | ISS | |
| PTHR10292:SF1 | Panther | CLATHRIN HEAVY CHAIN | JGI | ISS | |
| PF01394 | PFAM | Clathrin propeller repeat | JGI | ISS | |
| UniRef100_G7JBT5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Clathrin heavy chain n=1 Tax=Medicago truncatula RepID=G7JBT5_MEDTR | SoyBase | E_val: 1.00E-44 | ISS |
| UniRef100_I1MI28 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MI28_SOYBN | SoyBase | E_val: 3.00E-62 | ISS |
|
Glyma15g25450 not represented in the dataset |
Glyma15g25450 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g208000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g25450.1 sequence type=CDS gene model=Glyma15g25450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGGCTGCCAACGCTCCGATCGCCATGAGAGAAGCTCTCACCTTGCCAAGCATTGACATAAATCCGCAGTTCATCACTTTCACGCATGTGACGATGGAGTCTGATAAGTATATATGCGTTCGAGAAACGGCTCCGCAGAATAGTGTGGTTATCATTGATATGAACATGCCGAATCAGCCTTTGAGGAGGCCTATTACGGCAGATTCCGCTCTTATGAATCCAAATTCTAGAATCCTTGCTTTGAAAGGTTGGCTACTATTCCGTTGTATTCTTCTCATGAACTTGTGA
>Glyma15g25450.1 sequence type=predicted peptide gene model=Glyma15g25450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAAANAPIAMREALTLPSIDINPQFITFTHVTMESDKYICVRETAPQNSVVIIDMNMPNQPLRRPITADSALMNPNSRILALKGWLLFRCILLMNL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||