Glyma15g25160 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g25160

Feature Type:	gene_model
Chromosome:	Gm15
Start:	26495863
stop:	26496387
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g25160

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G48020	AT	Annotation by Michelle Graham. TAIR10: pectin methylesterase inhibitor 1 \| chr1:17716234-17716764 REVERSE LENGTH=176	SoyBase	E_val: 8.00E-21	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0090404	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: pollen tube tip	SoyBase	N/A	ISS
GO:0004857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity	SoyBase	N/A	ISS
GO:0030599	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity	SoyBase	N/A	ISS
GO:0046910	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity	SoyBase	N/A	ISS
PF04043	PFAM	Plant invertase/pectin methylesterase inhibitor	JGI		ISS
UniRef100_G7JFU8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase inhibitor n=1 Tax=Medicago truncatula RepID=G7JFU8_MEDTR	SoyBase	E_val: 3.00E-34	ISS
UniRef100_I1MI22	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MI22_SOYBN	SoyBase	E_val: 8.00E-123	ISS

Expression Patterns of Glyma15g25160

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g25160 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g207100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g25160

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g25160

Limit To All Plant Sequences

>Glyma15g25160.1   sequence type=CDS   gene model=Glyma15g25160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTCATAATTTCTCTTCTCTTTTGTTGGTGTTCCTATTATTTATTGCACCCACTTATGCAATCCCTATTGAGCAAGTGAGTTCCATTTGCAACCAAAGCAAAAGGCCTTCATTTTGTTTCGCTCTTCTCAACTCAAAACCAAAAGCAAATCTTGTTAGCCTTACTCAATACACCATTGACACAACACGTACAAATGTGACCAACACAATCAAATTAATCAATTCTTTGATTGCACAAAGTGTTAATGATCCAAAAGCAAAAAACCATTACAAATCGTGCTTGGAACATTTCAAGGGTGCCCTTTATAATGTGGACTACACTCAAGAGTTGTTGAAGAAAGGAGACTACCAAGGCGTGAATGTGGCTGCATCTTCAATACAAACTAATGTTGACGATTGTATTTCAGGAGAGTCACCAACTGATCCTCCTTATCATGATCCATCCATGCTTCCGAAATATGCTTCCATTATTGAGTTGGTTGTTGAAATTATTCTTATCATATCAAATTCCCTTCTTCGTTAG

Predicted protein sequences of Glyma15g25160

Limit To All Plant Sequences

>Glyma15g25160.1   sequence type=predicted peptide   gene model=Glyma15g25160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVHNFSSLLLVFLLFIAPTYAIPIEQVSSICNQSKRPSFCFALLNSKPKANLVSLTQYTIDTTRTNVTNTIKLINSLIAQSVNDPKAKNHYKSCLEHFKGALYNVDYTQELLKKGDYQGVNVAASSIQTNVDDCISGESPTDPPYHDPSMLPKYASIIELVVEIILIISNSLLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain