|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G46490 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G35110.1); Has 34 Blast hits to 34 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 33; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:19079457-19079861 FORWARD LENGTH=134 | SoyBase | E_val: 2.00E-21 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_I1MI05 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MI05_SOYBN | SoyBase | E_val: 1.00E-76 | ISS |
| UniRef100_Q9FYR1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Gb|AAD20160.1 n=1 Tax=Arabidopsis thaliana RepID=Q9FYR1_ARATH | SoyBase | E_val: 7.00E-18 | ISS |
|
Glyma15g24610 not represented in the dataset |
Glyma15g24610 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g202600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g24610.1 sequence type=CDS gene model=Glyma15g24610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCGCCGCCGCAGATGGGCTCTTCCGGCCGATCTACGAGGGCTGCATCTCCGCCTACGACAACGACGTCGAGCGCCGCCCCTACCACAAGAACTGCGGCTGCGCTCTGCACAGCAAGTCGAGGAGGAACAGCAGAGCGTGCACGCACAAGTTGCCGAAATGCAACAACGTGTCCTACCCCATGAGGAGGGCTTGGAGTGAAGGGAGCTTGTCAATGGCTTCGGCAACAACTTCCGCGCATTCCTCTCCTTCTTCTTCTCCCGCCGCTGGGTTCAGGCCTCAACACGACGAAGAGGGAAATAGTAACAAATTAGGAGTTTTATTTGAGATGTGA
>Glyma15g24610.1 sequence type=predicted peptide gene model=Glyma15g24610 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAAAADGLFRPIYEGCISAYDNDVERRPYHKNCGCALHSKSRRNSRACTHKLPKCNNVSYPMRRAWSEGSLSMASATTSAHSSPSSSPAAGFRPQHDEEGNSNKLGVLFEM*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||