Glyma15g24111 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g24111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g24111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g24111

Feature Type:	gene_model
Chromosome:	Gm15
Start:	24722965
stop:	24723534
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g24111

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12610	AT	Annotation by Michelle Graham. TAIR10: Leucine-rich repeat (LRR) family protein \| chr3:4006661-4007779 REVERSE LENGTH=372	SoyBase	E_val: 1.00E-46	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0009650	GO-bp	Annotation by Michelle Graham. GO Biological Process: UV protection	SoyBase	N/A	ISS
GO:0042493	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to drug	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF645	Panther		JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
UniRef100_B9RHG2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine-threonine protein kinase, plant-type, putative n=1 Tax=Ricinus communis RepID=B9RHG2_RICCO	SoyBase	E_val: 5.00E-53	ISS
UniRef100_UPI0002337112	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337112 related cluster n=1 Tax=unknown RepID=UPI0002337112	SoyBase	E_val: 2.00E-87	ISS

Expression Patterns of Glyma15g24111

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g24111 not represented in the dataset	Glyma15g24111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g24111 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g201900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g24111

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g24111

Limit To All Plant Sequences

>Glyma15g24111.1   sequence type=CDS   gene model=Glyma15g24111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCTCCAACTGCTGTCTCAACTGGTACGGCATCAGTTGCGACGCCACCACCGGCCGCGTCAGCGACATCAACCTCCACGGGGAGTCCGAAGACCCAATCTTTGAGAAAGTTGGTCGCTCCGGCTACATGAATGGAAAATTCTCACCAGCGATCTGCGGCGTCGACACCCTCACCACCCTTGTCCTCTCTGGCGAGATTCCCGCTGATGTCGACAAACTCTCATGTCTGACAGTCTTGAACCTCGCCGACAACGCCCTCAGCGGCAAAATTCCAGCGTCCATCACCCGACTGGGCTCACTGAAACACCTCGACCTCATCAATAATCAGTTCTACGGTGAGATTCCGGAAGACTTCGGGAATCTGGCCATGCTGAGCCGCATGTTGCTGAGTCGGAACCAGCTAATTTGTACGTCGTTGAGAGAGAGTTACGGAGAGTACGTATGGCTGAGAGAGGGAGAGAGAGCTGGTGTGCGTTGA

Predicted protein sequences of Glyma15g24111

Limit To All Plant Sequences

>Glyma15g24111.1   sequence type=predicted peptide   gene model=Glyma15g24111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSNCCLNWYGISCDATTGRVSDINLHGESEDPIFEKVGRSGYMNGKFSPAICGVDTLTTLVLSGEIPADVDKLSCLTVLNLADNALSGKIPASITRLGSLKHLDLINNQFYGEIPEDFGNLAMLSRMLLSRNQLICTSLRESYGEYVWLREGERAGVR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain