|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G19830 | AT | Annotation by Michelle Graham. TAIR10: SNF7 family protein | chr2:8558101-8559389 REVERSE LENGTH=213 | SoyBase | E_val: 9.00E-22 | ISS |
| GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
| GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0000815 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ESCRT III complex | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PF03357 | PFAM | Snf7 | JGI | ISS | |
| UniRef100_I1MHY3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MHY3_SOYBN | SoyBase | E_val: 1.00E-40 | ISS |
| UniRef100_O82197 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting-associated protein 32 homolog 1 n=1 Tax=Arabidopsis thaliana RepID=VP321_ARATH | SoyBase | E_val: 4.00E-19 | ISS |
|
Glyma15g23845 not represented in the dataset |
Glyma15g23845 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g23845.1 sequence type=CDS gene model=Glyma15g23845 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TGCCAAGGCTACCACAAAAGTGTTGATGCATTAAGAACTGGAGCCACTGCTATGAGGGCTATGCAAAAAGAAACATATACAAAGAACATGAAACAAATTCAGGAAGCATTGTCTACTCCAATCGATGCAGCTACTGACTTTGATGAGGATGAATTGGAAGCAGAACTTGAAGACCTAGAGGGTGTTGAATTGGAAGAACAACTTCTTCAGCCTACAACTAGAGCTCCAGCTGCTCTAGTGCATCCCACTGCCAAGGAAGATGAATTGGCAGCTTTGCAGGCTGAGATGGCACTTTGA
>Glyma15g23845.1 sequence type=predicted peptide gene model=Glyma15g23845 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CQGYHKSVDALRTGATAMRAMQKETYTKNMKQIQEALSTPIDAATDFDEDELEAELEDLEGVELEEQLLQPTTRAPAALVHPTAKEDELAALQAEMAL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||