Report for Sequence Feature Glyma15g23830
Feature Type: gene_model
Chromosome: Gm15
Start: 23835566
stop: 23836607
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g23830
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G22142 AT
Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr3:7803604-7808046 REVERSE LENGTH=1480
SoyBase E_val: 1.00E-32 ISS
PF02095 PFAM
Extensin-like protein repeat
JGI ISS
UniRef100_I1MHY1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHY1_SOYBN
SoyBase E_val: 1.00E-97 ISS
UniRef100_P13993 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max RepID=PRP2_SOYBN
SoyBase E_val: 2.00E-57 ISS
Expression Patterns of Glyma15g23830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g23830
Paralog Evidence Comments
Glyma09g12252 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g23830 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g199700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g23830
Coding sequences of Glyma15g23830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g23830.1 sequence type=CDS gene model=Glyma15g23830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTAACATGACTTCCTTAAGCTCCTTAGTGCTGCTCCTTGCAGCTCTAATTCTATTCCCTCAAGTTCTTGCTGACTATGAGAAGGCCCCGGTGTACAAGCCTCCCATTGAGAAGCCACCACTTTACAAGCCCCCAATTGAGAAACCTCCTGTTTATAAACCTCCAGTTGAGAAACCCCCCATTTATAAGCCCCCAGTAGAGAAGCCACCAGTGTACAAGCCTCCAGTAGAGAAACCCCCAGTTTACAAGCCCCCAGTTGAAAAACCACCAGTTGAGAAACCCCCAGTAGAGAAGCCTCCAGTTTACAAGCCCCCAGTTGAAAAACCACCAGTGTACAAGCCACCAGTTGAGAACCCTCCAATTTACAAACCCCCAGTTGAAAAACCACCAGTATACAAGCCCCCAATTGAGAAACCTCCAGTTTATAAGCCACCAGTAGAGAAGCCACCGGTTGAGAAGCCTCCAGTCTACAAGCCACCATATGGAAAGCCACCATACCCAAAGTACCCTCCAATTGATGACACCCATTTCTGA
Predicted protein sequences of Glyma15g23830
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g23830.1 sequence type=predicted peptide gene model=Glyma15g23830 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSNMTSLSSLVLLLAALILFPQVLADYEKAPVYKPPIEKPPLYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVEKPPVEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVEKPPVYKPPYGKPPYPKYPPIDDTHF*