SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g23770

Feature Type:gene_model
Chromosome:Gm15
Start:23558093
stop:23559407
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g23770
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G33080AT Annotation by Michelle Graham. TAIR10: AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein | chr4:15960146-15964296 FORWARD LENGTH=507 SoyBaseE_val: 4.00E-32ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24358Panther SERINE/THREONINE-PROTEIN KINASE 38 JGI ISS
PTHR24358:SF32Panther JGI ISS
UniRef100_G7J8B8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase 38-like protein n=2 Tax=Medicago truncatula RepID=G7J8B8_MEDTR SoyBaseE_val: 2.00E-35ISS
UniRef100_I1JTZ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JTZ3_SOYBN SoyBaseE_val: 4.00E-38ISS

Expression Patterns of Glyma15g23770
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g23770 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g23770
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g23770
>Glyma15g23770.1   sequence type=CDS   gene model=Glyma15g23770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TACCCTAACGACCTCGAAAGAAAAGACAAAAGAGCCATCAATGGAAATATGAGATTATATGTGACTTCAATTCCCTGCTTTAAATTATTACTTAGAGAGCATATCTGTATTCTCTCTGATTTTGGTCTCTGTAAGCCTCTCGATTGTATTGCCTTGTCTACACTGCATGAAAATCAGACCATAGATGATGAAACTTTGGCAGAACTAATGGATAGAAGTCCACGTGGACAGCTTCAACATTGGCAGATGAACAGGAGGAAGTTGTTCTTACCTTATGTTTTAGGCCATGTGAATCTATCAGTCATGAAGCACGATTTTTTGTTGTATTTAATGTGCAAGCAATACTTAACAATATTTCATATGGACAGGTGGTCATTTGGAGCAATAATGTATGAAATATTGGTTGGTTACCCTCCATTTTACTCCGATGACCAAATAACCACATGCAGAAAGGTACCATCCTTAATCGGCTTAATGGCTTCTCATAAACATAATAATTTGTTGCATCTTATTTGTAGTTTAATTTGA
Predicted protein sequences of Glyma15g23770
>Glyma15g23770.1   sequence type=predicted peptide   gene model=Glyma15g23770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
YPNDLERKDKRAINGNMRLYVTSIPCFKLLLREHICILSDFGLCKPLDCIALSTLHENQTIDDETLAELMDRSPRGQLQHWQMNRRKLFLPYVLGHVNLSVMKHDFLLYLMCKQYLTIFHMDRWSFGAIMYEILVGYPPFYSDDQITTCRKVPSLIGLMASHKHNNLLHLICSLI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo