|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G53450 | AT | Annotation by Michelle Graham. TAIR10: OBP3-responsive gene 1 | chr5:21689204-21692242 FORWARD LENGTH=670 | SoyBase | E_val: 1.00E-24 | ISS |
| GO:0006468 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein phosphorylation | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0004672 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein kinase activity | SoyBase | N/A | ISS |
| GO:0005198 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural molecule activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0016301 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: kinase activity | SoyBase | N/A | ISS |
| GO:0016772 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups | SoyBase | N/A | ISS |
| UniRef100_B9RII2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9RII2_RICCO | SoyBase | E_val: 7.00E-23 | ISS |
| UniRef100_I1JYT0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1JYT0_SOYBN | SoyBase | E_val: 8.00E-34 | ISS |
|
Glyma15g23723 not represented in the dataset |
Glyma15g23723 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g23723.1 sequence type=CDS gene model=Glyma15g23723 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATCCTTTGATTTTTGCAAAGTTCAAATCGTTCCTCACAAAGGAGTATGATCCTTCATGTCTGTGGGAGTTTATGTTGGAAATCCTTGGCAGAAGTTCCCCTTATGGAAATGCTGGATTACAAATACTTGATAGGAACTGGGGAGCTGGTTGGCACCTTTTATTGTTATTGCTTGCTACTAAACCTTCTCTAAGGATAAGGTATGCTATGAAGAAATATTGCTAG
>Glyma15g23723.1 sequence type=predicted peptide gene model=Glyma15g23723 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDPLIFAKFKSFLTKEYDPSCLWEFMLEILGRSSPYGNAGLQILDRNWGAGWHLLLLLLATKPSLRIRYAMKKYC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||