Glyma15g23610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g23610

Feature Type:	gene_model
Chromosome:	Gm15
Start:	23228719
stop:	23230017
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g23610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G54340	AT	Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein \| chr3:20119428-20121087 REVERSE LENGTH=232	SoyBase	E_val: 6.00E-22	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009827	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0009886	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0010093	GO-bp	Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity	SoyBase	N/A	ISS
GO:0048440	GO-bp	Annotation by Michelle Graham. GO Biological Process: carpel development	SoyBase	N/A	ISS
GO:0048441	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal development	SoyBase	N/A	ISS
GO:0048443	GO-bp	Annotation by Michelle Graham. GO Biological Process: stamen development	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0048507	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
KOG0014	KOG	MADS box transcription factor	JGI		ISS
PTHR11945	Panther	MADS BOX PROTEIN	JGI		ISS
PTHR11945:SF76	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00319	PFAM	SRF-type transcription factor (DNA-binding and dimerisation domain)	JGI		ISS
UniRef100_I1MHX2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MHX2_SOYBN	SoyBase	E_val: 2.00E-155	ISS
UniRef100_Q5VKS3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: MADS-box protein GmNMH7 n=2 Tax=Glycine max RepID=Q5VKS3_SOYBN	SoyBase	E_val: 5.00E-40	ISS

Expression Patterns of Glyma15g23610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g23610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g23610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g23610

Limit To All Plant Sequences

>Glyma15g23610.1   sequence type=CDS   gene model=Glyma15g23610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATCGAGCAAGTGAAGAAGCTGCTAGCTAGAGGAAAGATCCAGATCAAGAGGATAGAGAACACCACCAAGAAGGCCAACAAGCTCACCGTTCACTGCGATGCCAAGGTTTCTATTATTATGTTCTCCAGCACTGGAAAACTCCACAAGATCGAGCAATCAACAAAGCAGTTCTTCGATCAATACCAGATGACTCTGGGAGTTGATATTTGGAACTCTCATTACGAGAATATGCAAGAGAACTTGAAGAAACTGAAAGAGGTGAATATGAATCTTCTTAAGGAGTTTAGGTATATATATCTTTCATCACTTCGATCGATCTCTTTGGTTGTAAGTTACAAAGTCTTGAATAAGCAATTATGTTCTCAAGATGCATGGGAGATTGTAGAGAAAGGTTATACCCAACCTCAAAATGAGGCTATTTTGTCACCAAATGAGAAGGAGACTTTGTTGAAGTCGAAGAAGAAGGATCAACAAGCACTTACTTTCATTCATCAAGGTTTGGATGAAGTTATGTTCGAGTTGGTGTCAAATGCAACCACATCCAAAGAAGCATGGGAGATTTTGAAAACCTCCCTTGAAGGTGTTGATAAGGAATCCGAATCTATCTCAGATTTTGGCAACAAGGTGTTGGCTATTGTGAACCAAATGAAG

Predicted protein sequences of Glyma15g23610

Limit To All Plant Sequences

>Glyma15g23610.1   sequence type=predicted peptide   gene model=Glyma15g23610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IEQVKKLLARGKIQIKRIENTTKKANKLTVHCDAKVSIIMFSSTGKLHKIEQSTKQFFDQYQMTLGVDIWNSHYENMQENLKKLKEVNMNLLKEFRYIYLSSLRSISLVVSYKVLNKQLCSQDAWEIVEKGYTQPQNEAILSPNEKETLLKSKKKDQQALTFIHQGLDEVMFELVSNATTSKEAWEILKTSLEGVDKESESISDFGNKVLAIVNQMK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain