|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G25190 | AT | Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr5:8707007-8707655 REVERSE LENGTH=181 | SoyBase | E_val: 1.00E-47 | ISS |
GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0009740 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway | SoyBase | N/A | ISS |
GO:0009873 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway | SoyBase | N/A | ISS |
GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
PF00847 | PFAM | AP2 domain | JGI | ISS | |
UniRef100_D5L105 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AP2 domain class transcription factor n=1 Tax=Malus x domestica RepID=D5L105_MALDO | SoyBase | E_val: 4.00E-57 | ISS |
UniRef100_I1MHX0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHX0_SOYBN | SoyBase | E_val: 3.00E-90 | ISS |
Glyma15g23560 not represented in the dataset |
Glyma15g23560 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.15g197900 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g23560.1 sequence type=CDS gene model=Glyma15g23560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTGCAAGAAAACTAGGATATGGCTAGGAACTTTTGAAACTGTTGAGGGTGCAACTAGAGCCTATGATGAAGCAGTAAGGCTAATGTGTGGCACAAGAGCAAGAACAAACTTCCCTTACAACCCCAATGCGTCTCAGTCATCATCTTCCAAGCTTCTCTCAGCAACTTTAACTGCAAAACTGCATAGGTGCTACATGGCTTCTTTGCAAATGACAAGGCCATCAATTCACAGGCAGAGCCTTAGACAACAAGAAGAGGAGCAAGAAGCAAAAAGGAATTGGGTTTTCAAGAAGGTTAAGGACCACATCGAGCAAATGATAGAGGAGTTGCTGCATTACGGGTCTATTGAGCTATGCTCTGTGATTCCACCACAGGCTCTTTGA
>Glyma15g23560.1 sequence type=predicted peptide gene model=Glyma15g23560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MCKKTRIWLGTFETVEGATRAYDEAVRLMCGTRARTNFPYNPNASQSSSSKLLSATLTAKLHRCYMASLQMTRPSIHRQSLRQQEEEQEAKRNWVFKKVKDHIEQMIEELLHYGSIELCSVIPPQAL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||