SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g23500

Feature Type:gene_model
Chromosome:Gm15
Start:22880609
stop:22883501
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g23500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30270AT Annotation by Michelle Graham. TAIR10: CBL-interacting protein kinase 23 | chr1:10655270-10658524 FORWARD LENGTH=482 SoyBaseE_val: 2.00E-117ISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007584GO-bp Annotation by Michelle Graham. GO Biological Process: response to nutrient SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010107GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion import SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24345Panther SERINE/THREONINE-PROTEIN KINASE PLK JGI ISS
PTHR24345:SF45Panther SERINE/THREONINE-PROTEIN KINASE PLK1 JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
PF03822PFAM NAF domain JGI ISS
UniRef100_G7IIY1UniRef Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting protein kinase n=2 Tax=Medicago truncatula RepID=G7IIY1_MEDTR SoyBaseE_val: 3.00E-128ISS
UniRef100_UPI000233BEA2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BEA2 related cluster n=1 Tax=unknown RepID=UPI000233BEA2 SoyBaseE_val: 3.00E-154ISS

Expression Patterns of Glyma15g23500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g23500
ParalogEvidenceComments
Glyma09g11770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g23500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g197300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g23500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g23500
>Glyma15g23500.2   sequence type=CDS   gene model=Glyma15g23500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGCTATTTGCCCTTTGAAGAAACCAATCTATCAGCTTTATATAAAAAGATTTTCAAGGCCGAGTTCATGTCTCCTCCATGGTTCTCTTCAAGTGCAAAGAAGCTAATCAACAAAATCCTTGATCCCAATCCTGCCACTCGGATTACATTTGCTGAGGTCATTGAGAATGACTGGTTCAAGAAGGGATATAAGCCACCCGTATTTGAACAGGCTAATATTAGTCTTGATGATGTAGATTCTATTTTCAGTAATTCTACGGATTCACAAAATCTTGTTATAGAGAGGCGCGAAGAGGGGCCCATGGCACCTGTGGCACCTGTGACTATGAACGCCTTTGAGCTTATCTCTAAATCTCAGGGCCTCAATCTTAGTAGTCTTTTTGAGAAGCAAATGGGACTAGTTAAAAGGGAAACACGGTTCACATCCAAATGTTCAGCAGATGAAATAATTTCAAAAATTGAGAAAGCTGCAGGACCCCTGGGTTTTGATGTTAAGAAGAACAACTGTAAGTTAAAGATTGAAGGCGAAAAGACTGGACGCAAAGGTCATCTATCTGTAGCCACTGAGATCTTAGAGGTTGCCCCTTCACTATACATGGTTGAGCTGCGTAAGTCTGAAGGAGATACTCTCGAATTTCACAAGAGTAGCCAGCCATGGACACCATCCTAG
Predicted protein sequences of Glyma15g23500
>Glyma15g23500.2   sequence type=predicted peptide   gene model=Glyma15g23500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGYLPFEETNLSALYKKIFKAEFMSPPWFSSSAKKLINKILDPNPATRITFAEVIENDWFKKGYKPPVFEQANISLDDVDSIFSNSTDSQNLVIERREEGPMAPVAPVTMNAFELISKSQGLNLSSLFEKQMGLVKRETRFTSKCSADEIISKIEKAAGPLGFDVKKNNCKLKIEGEKTGRKGHLSVATEILEVAPSLYMVELRKSEGDTLEFHKSSQPWTPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo