SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g22801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g22801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g22801

Feature Type:gene_model
Chromosome:Gm15
Start:21608776
stop:21612950
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55520AT Annotation by Michelle Graham. TAIR10: FKBP-like peptidyl-prolyl cis-trans isomerase family protein | chr3:20594177-20595128 FORWARD LENGTH=190 SoyBaseE_val: 6.00E-44ISS
GO:0000413GO-bp Annotation by Michelle Graham. GO Biological Process: protein peptidyl-prolyl isomerization SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0018208GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline modification SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
GO:0005528GO-mf Annotation by Michelle Graham. GO Molecular Function: FK506 binding SoyBaseN/AISS
PTHR10516Panther FK506 BINDING PROTEIN JGI ISS
PTHR10516:SF72Panther PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-RELATED JGI ISS
PF00254PFAM FKBP-type peptidyl-prolyl cis-trans isomerase JGI ISS
UniRef100_C6SZE3UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SZE3_SOYBN SoyBaseE_val: 3.00E-43ISS
UniRef100_C6SZE3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase n=1 Tax=Glycine max RepID=C6SZE3_SOYBN SoyBaseE_val: 3.00E-43ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g22801 not represented in the dataset

Glyma15g22801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g22801.1   sequence type=CDS   gene model=Glyma15g22801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATAGTAACAAAGGCTTGGGAAATTGCAGTGAAAATCGTGAAGGTTGGAGAAGTTGCAAAAATAACTTGCAAGCCAGAATATGCATATGGTAGTGCAGGATCTCCTCCAGATATTTTTCCGGATGCAACACTTGTTTTTGAAGTTGAGCTAGTTGCCTGTCAGCCAAGGAAGGGCTCCAGTTTGGGAAGTGTTTCAAAGGAGAGGGCTAGGCTTGATGAACTGAAGAAGCAGAGAGAGCTAGCTGCTACTGCCAAAGAGGAGAAGAAAAAGTAG

>Glyma15g22801.1   sequence type=predicted peptide   gene model=Glyma15g22801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IVTKAWEIAVKIVKVGEVAKITCKPEYAYGSAGSPPDIFPDATLVFEVELVACQPRKGSSLGSVSKERARLDELKKQRELAATAKEEKKK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo