Glyma15g22625 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g22625

Feature Type:	gene_model
Chromosome:	Gm15
Start:	21219348
stop:	21221604
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g22625

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32110	AT	Annotation by Michelle Graham. TAIR10: Beta-1,3-N-Acetylglucosaminyltransferase family protein \| chr4:15515769-15516408 REVERSE LENGTH=124	SoyBase	E_val: 2.00E-13	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008378	GO-mf	Annotation by Michelle Graham. GO Molecular Function: galactosyltransferase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
UniRef100_D7MAR6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Galactosyltransferase n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MAR6_ARALL	SoyBase	E_val: 2.00E-12	ISS
UniRef100_I1MHT4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHT4_SOYBN	SoyBase	E_val: 5.00E-56	ISS

Expression Patterns of Glyma15g22625

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g22625 not represented in the dataset	Glyma15g22625 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g22625

Paralog	Evidence	Comments
Glyma09g10460	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g22625 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g193500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g22625

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g22625

Limit To All Plant Sequences

>Glyma15g22625.1   sequence type=CDS   gene model=Glyma15g22625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGGAAAAGTGTCAAATGTTCTTGCCATAGTTTTCTTCCTTGTTCTCATTTCTCAAGGCTTTAACGAATGCTTCTTAAGTGATGTCTCCATAAGGCAATCTAGAATAGGAAATCTAATCTTGAATTTCAAAGGATTTCAGTCCATTGAACACATAAATCCTTCACTTTTGACAGTCTCAAGTGATTTGTGTCTTGTTAATGCTGATCAACCAATCTATAAGAGTGTTATCAAATTCAAATATGTTTGGGACTACAGATTTCTATTAAATCCATTTCCTCAAACTAATATAATTGTCTTATAA

Predicted protein sequences of Glyma15g22625

Limit To All Plant Sequences

>Glyma15g22625.1   sequence type=predicted peptide   gene model=Glyma15g22625   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKGKVSNVLAIVFFLVLISQGFNECFLSDVSIRQSRIGNLILNFKGFQSIEHINPSLLTVSSDLCLVNADQPIYKSVIKFKYVWDYRFLLNPFPQTNIIVL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain