SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21805): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21805): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21805

Feature Type:gene_model
Chromosome:Gm15
Start:20059262
stop:20060081
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g21805
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56610AT Annotation by Michelle Graham. TAIR10: Phosphotyrosine protein phosphatases superfamily protein | chr5:22916738-22918137 FORWARD LENGTH=228 SoyBaseE_val: 1.00E-49ISS
GO:0006470GO-bp Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation SoyBaseN/AISS
GO:0016311GO-bp Annotation by Michelle Graham. GO Biological Process: dephosphorylation SoyBaseN/AISS
GO:0043407GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of MAP kinase activity SoyBaseN/AISS
GO:0046855GO-bp Annotation by Michelle Graham. GO Biological Process: inositol phosphate dephosphorylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0004439GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity SoyBaseN/AISS
GO:0004725GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine phosphatase activity SoyBaseN/AISS
GO:0008138GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine/serine/threonine phosphatase activity SoyBaseN/AISS
GO:0016791GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatase activity SoyBaseN/AISS
PTHR10159Panther DUAL SPECIFICITY PROTEIN PHOSPHATASE JGI ISS
PTHR10159:SF5Panther PTEN-RELATED PHOSPHATASE (PLIP) JGI ISS
UniRef100_G7L7D1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein-tyrosine phosphatase mitochondrial n=1 Tax=Medicago truncatula RepID=G7L7D1_MEDTR SoyBaseE_val: 4.00E-74ISS
UniRef100_UPI000233B01FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B01F related cluster n=1 Tax=unknown RepID=UPI000233B01F SoyBaseE_val: 4.00E-102ISS

Expression Patterns of Glyma15g21805
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21805 not represented in the dataset
Glyma15g21805 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21805 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g189600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g21805
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g21805
>Glyma15g21805.1   sequence type=CDS   gene model=Glyma15g21805   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATTGAGGAATTGGATGATGGAGAGTGTAGTAGGGACGAGGAAGAGAAGTGTCAGAGGCAGATTGTGAGCATTGATGCAAAGAGAGCGTTGGTTGGAGCAGGTGCTTGGATCTTGTTCTACCCCACACTCTTGTATAATGTGCTTCGTAACCAGATTGAAGTTGAGTTTAGGTGGTGGGATCATATTGACGAGTTTTTGTTACTGGGCACTGTTCCATTCCCCAAAGATGTTCCTCACTTGAATAAGGTTGGTGTGGGTGGTGTGATTACTCTCAATGAGCCCTACGAAACCTTGGTGCAGTTGTATCAGGCTCACGGGATTGATCATTTGGTGATTCCCACCAGGGATTATCTCTATGCCCCCTCCTTCGTGGATATCAATCGAGCTGTGCATACTTATGTTTTTCCATACTTATGTTTTTCAGGTTGA
Predicted protein sequences of Glyma15g21805
>Glyma15g21805.1   sequence type=predicted peptide   gene model=Glyma15g21805   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIEELDDGECSRDEEEKCQRQIVSIDAKRALVGAGAWILFYPTLLYNVLRNQIEVEFRWWDHIDEFLLLGTVPFPKDVPHLNKVGVGGVITLNEPYETLVQLYQAHGIDHLVIPTRDYLYAPSFVDINRAVHTYVFPYLCFSG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo