Glyma15g21780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21780

Feature Type:	gene_model
Chromosome:	Gm15
Start:	20046946
stop:	20050032
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g21780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36060	AT	Annotation by Michelle Graham. TAIR10: MMS ZWEI homologue 3 \| chr2:15143012-15143998 REVERSE LENGTH=144	SoyBase	E_val: 4.00E-77	ISS
GO:0006301	GO-bp	Annotation by Michelle Graham. GO Biological Process: postreplication repair	SoyBase	N/A	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0022402	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell cycle process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0031372	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: UBC13-MMS2 complex	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0016881	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity	SoyBase	N/A	ISS
KOG0896	KOG	Ubiquitin-conjugating enzyme E2	JGI		ISS
PTHR24067	Panther	UBIQUITIN-CONJUGATING ENZYME E2	JGI		ISS
PTHR24067:SF8	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00179	PFAM	Ubiquitin-conjugating enzyme	JGI		ISS
UniRef100_E9JFV5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating family protein n=3 Tax=fabids RepID=E9JFV5_9ROSI	SoyBase	E_val: 8.00E-78	ISS
UniRef100_I1MHQ5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MHQ5_SOYBN	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma15g21780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21780 not represented in the dataset	Glyma15g21780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g189500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g21780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g21780

Limit To All Plant Sequences

>Glyma15g21780.2   sequence type=CDS   gene model=Glyma15g21780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTACAGGATTACAAGACTCTTTGCCAAAATCAATTGGGCCTCTTCCTTTCGATGGAGGTGTGACAGTTCCTAGAAACTTCAGATTGCTAGAGGAGCTTGAACGTGGTGAAAAAGGAATTAGAGATGGCACAATTAGCTATGTAATGGATGATGGTGATGACATTTACATGCGCTCTAGGACTGGCACCATTATTGGCCCCCAAAATACTATACATGAAGGAAAAATTTATCAACTGAAGCTGTTTGGTGATAAAGACTACCCAGAAAAGCCCCCTAGTGTTCGGTTTCATTCACGAATCAACATGACTTGTGTTGAACCAAAGAAATTTGGTCTTCTTGCAAATTGGCAAAGAGAGTACACCATGGAGGACATACTGACACAGTTGAAGAAGGAAATGGCCGCTCCTCATAACCGGAAGCTTGTCCAACCTCCAGAAGTGTGTAATGCTTTGTGGATCCATCTTTCTGAATTCTAG

Predicted protein sequences of Glyma15g21780

Limit To All Plant Sequences

>Glyma15g21780.2   sequence type=predicted peptide   gene model=Glyma15g21780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MITGLQDSLPKSIGPLPFDGGVTVPRNFRLLEELERGEKGIRDGTISYVMDDGDDIYMRSRTGTIIGPQNTIHEGKIYQLKLFGDKDYPEKPPSVRFHSRINMTCVEPKKFGLLANWQREYTMEDILTQLKKEMAAPHNRKLVQPPEVCNALWIHLSEF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain