Glyma15g21381 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21381

Feature Type:	gene_model
Chromosome:	Gm15
Start:	19620991
stop:	19621777
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g21381

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00510	AT	Annotation by Michelle Graham. TAIR10: NADH dehydrogenase subunit 7 \| chrM:132071-138153 FORWARD LENGTH=394	SoyBase	E_val: 1.00E-39	ISS
GO:0045333	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular respiration	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003954	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity	SoyBase	N/A	ISS
GO:0016651	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H	SoyBase	N/A	ISS
GO:0048038	GO-mf	Annotation by Michelle Graham. GO Molecular Function: quinone binding	SoyBase	N/A	ISS
GO:0051287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NAD binding	SoyBase	N/A	ISS
PTHR11993	Panther	NADH DEHYDROGENASE-RELATED	JGI		ISS
PTHR11993:SF10	Panther	gb def: carbon monoxide-induced hydrogenase	JGI		ISS
PF00346	PFAM	Respiratory-chain NADH dehydrogenase, 49 Kd subunit	JGI		ISS
UniRef100_I1MHP0	UniRef	Annotation by Michelle Graham. Best UniRef hit: DNA polymerase n=1 Tax=Glycine max RepID=I1MHP0_SOYBN	SoyBase	E_val: 6.00E-119	ISS
UniRef100_I1MHP0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA polymerase n=1 Tax=Glycine max RepID=I1MHP0_SOYBN	SoyBase	E_val: 6.00E-119	ISS

Expression Patterns of Glyma15g21381

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21381 not represented in the dataset	Glyma15g21381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21381 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g21381

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g21381

Limit To All Plant Sequences

>Glyma15g21381.1   sequence type=CDS   gene model=Glyma15g21381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCAGCAGGAGGTCAGCCTGCTGCCAATCCTGCAGCGGAGCAACCCTCAAACGTGCCTTCAGGCGCATCGACCTCGGGCTGGAGAAGTTTCGAAGAAGGTGTTTTGTTAGAATCTTCAAACGAATCCAGCGAAGCGAGCGTGAATCAGCAGCCTGTGATTCCCGAACTTGAACCTCCGCTTCTCGATGACAACACCCGGCGAGCAGAGCTCGCTGTTCGATTGAGGGCGAATTGGTGGGGGATCGCTTATAACGAGCGAATCCTCGACTCCTTCATCCGGAGTCAACTTGCAATCGAAAGGCACATAGAGGCCGCACTTGTGGCGGACGGATATTCCCCTCAAGTAGTCTTTGAAAGAAGACATATGATTCGTGGCTTTCTTTTCTATCCTGCCAATTTTGCTCCTTCTACCTATACCGCTGTTGAAGCACCTAAAGGAGAATTTGGTGTCTTTCTGGTCAGTAATGGAAGCAATCGTCCCTACCGTCATAAAATAAGAGCACCTGGCTCTGCCCATTCACAAGGACTCGATTCTCTGTCCAAACATCACATGCCAGCAGATGTGGTCACCATCATAGGTACTCAAGATATTGTGTCTGGAGAGGTGGATAGATAG

Predicted protein sequences of Glyma15g21381

Limit To All Plant Sequences

>Glyma15g21381.1   sequence type=predicted peptide   gene model=Glyma15g21381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPAGGQPAANPAAEQPSNVPSGASTSGWRSFEEGVLLESSNESSEASVNQQPVIPELEPPLLDDNTRRAELAVRLRANWWGIAYNERILDSFIRSQLAIERHIEAALVADGYSPQVVFERRHMIRGFLFYPANFAPSTYTAVEAPKGEFGVFLVSNGSNRPYRHKIRAPGSAHSQGLDSLSKHHMPADVVTIIGTQDIVSGEVDR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain