Glyma15g21301 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21301): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21301): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21301

Feature Type:	gene_model
Chromosome:	Gm15
Start:	19513194
stop:	19515220
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g21301

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G45040	AT	Annotation by Michelle Graham. TAIR10: phosphatidate cytidylyltransferase family protein \| chr3:16472801-16475702 REVERSE LENGTH=569	SoyBase	E_val: 1.00E-41	ISS
GO:0008654	GO-bp	Annotation by Michelle Graham. GO Biological Process: phospholipid biosynthetic process	SoyBase	N/A	ISS
GO:0009697	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0030968	GO-bp	Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0045087	GO-bp	Annotation by Michelle Graham. GO Biological Process: innate immune response	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0004168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dolichol kinase activity	SoyBase	N/A	ISS
GO:0004605	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidate cytidylyltransferase activity	SoyBase	N/A	ISS
PTHR13205	Panther	TRANSMEMBRANE PROTEIN 15-RELATED	JGI		ISS
PTHR13205:SF4	Panther	UNCHARACTERIZED	JGI		ISS
UniRef100_G8A151	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dolichol kinase n=1 Tax=Medicago truncatula RepID=G8A151_MEDTR	SoyBase	E_val: 4.00E-71	ISS
UniRef100_I1LTM1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LTM1_SOYBN	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma15g21301

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21301 not represented in the dataset	Glyma15g21301 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21301 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g187200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g21301

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g21301

Limit To All Plant Sequences

>Glyma15g21301.1   sequence type=CDS   gene model=Glyma15g21301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCATTGCAAGGAAGACGCATGGTTTCACCCAGCACTGAAGCTAGTGTGGGTCCTTTGTCATGGATTGGCATCTGTGAAACTAATTCAGCATTTCCTTAGAACTTTTCCCTTATGTGCTTTCATTGGCAAAACATTTTTGGTGACTTTCGGTATTGTTCTCTATTTTGGTGACATGTTGTTGCTTACTATTAAAAAGCTACATGGACTATTGATGTCATTAGAGTTAGTTAATGTAGAATATGAAATAAGTAAAAGTGAGATAAGCATTATAATTCAGGGGCTTGTGCTTGGTCTTCTGCTATATCCAATAGCTTTGAAATATATTCTCCAAATATGCGAGTGGTTTATAAATACAGCTTCTACTGAAGCAAAAAGATATTGTGAGATTGGGAGATCTCTTATGTTTGTTGCTTCCCTTGGAATTGTCCTAATTTTGATTGTACCATCATGGATGAAGTTCGTGCATGAGTTTCGAATGCATCCTTTTTTCTGGGTGCTTTCCTTTGTTTTCTCGTAG

Predicted protein sequences of Glyma15g21301

Limit To All Plant Sequences

>Glyma15g21301.1   sequence type=predicted peptide   gene model=Glyma15g21301   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDHCKEDAWFHPALKLVWVLCHGLASVKLIQHFLRTFPLCAFIGKTFLVTFGIVLYFGDMLLLTIKKLHGLLMSLELVNVEYEISKSEISIIIQGLVLGLLLYPIALKYILQICEWFINTASTEAKRYCEIGRSLMFVASLGIVLILIVPSWMKFVHEFRMHPFFWVLSFVFS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain