SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21271): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21271): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21271

Feature Type:gene_model
Chromosome:Gm15
Start:19487579
stop:19489231
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g21271
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G01690AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr2:309144-313499 REVERSE LENGTH=744 SoyBaseE_val: 4.00E-57ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
PTHR16023Panther TAX1 BINDING PROTEIN-RELATED JGI ISS
UniRef100_G7LAL0UniRef Annotation by Michelle Graham. Most informative UniRef hit: VAC14-like protein n=1 Tax=Medicago truncatula RepID=G7LAL0_MEDTR SoyBaseE_val: 2.00E-56ISS
UniRef100_I1KQB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KQB6_SOYBN SoyBaseE_val: 3.00E-62ISS

Expression Patterns of Glyma15g21271
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21271 not represented in the dataset
Glyma15g21271 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21271 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g187100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g21271
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g21271
>Glyma15g21271.1   sequence type=CDS   gene model=Glyma15g21271   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGATGACCGTTGTAGATTCCAACATCGTGGAATGTCGAAACCTTCAACGACGCAAAGTTTTTTGTTCATTTATCATTTTCTGACTCGAGCAGTGCTACTCTTGAAGTCTGTAGATTATGGTCGCATGGCTGAAATCCTGGTACATAGGGCAGGTTCTCCAGATGAATTCACTAGGCTAACAACTATCACATGGATAAATGAGTTTGTCAAGCTTGGTGGAGACCAGCTTGTTCCATATTATGCTGACATTCTTGGAGCCATTTTGCCTTGTATAGCAGATAAAGAAGAGAAAATTAGAGTTGTTGCTCGTGAAACCAATGAAGAGCTACGTGCCCTCAAGGCAGATCCAGCTGAAGCGTTTGATGTAGGAGCAATCTTGTCCATTGCCAGGAGGCAATTATCTAGTGAACTGGAGGCTACTTGA
Predicted protein sequences of Glyma15g21271
>Glyma15g21271.1   sequence type=predicted peptide   gene model=Glyma15g21271   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVDDRCRFQHRGMSKPSTTQSFLFIYHFLTRAVLLLKSVDYGRMAEILVHRAGSPDEFTRLTTITWINEFVKLGGDQLVPYYADILGAILPCIADKEEKIRVVARETNEELRALKADPAEAFDVGAILSIARRQLSSELEAT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo