Glyma15g21180 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g21180

Feature Type:	gene_model
Chromosome:	Gm15
Start:	19404336
stop:	19405785
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g21180

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G19940	AT	Annotation by Michelle Graham. TAIR10: oxidoreductases, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor;copper ion binding \| chr2:8613168-8615649 FORWARD LENGTH=401	SoyBase	E_val: 4.00E-67	ISS
GO:0006520	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid metabolic process	SoyBase	N/A	ISS
GO:0006526	GO-bp	Annotation by Michelle Graham. GO Biological Process: arginine biosynthetic process	SoyBase	N/A	ISS
GO:0008652	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005730	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleolus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003942	GO-mf	Annotation by Michelle Graham. GO Molecular Function: N-acetyl-gamma-glutamyl-phosphate reductase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0016620	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
GO:0051287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NAD binding	SoyBase	N/A	ISS
PTHR14097	Panther	TIP30 SER/THR KINASE-RELATED	JGI		ISS
PTHR14097:SF7	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_I1ND31	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: N-acetyl-gamma-glutamyl-phosphate reductase n=1 Tax=Glycine max RepID=I1ND31_SOYBN	SoyBase	E_val: 1.00E-86	ISS
UniRef100_I1ND31	UniRef	Annotation by Michelle Graham. Best UniRef hit: N-acetyl-gamma-glutamyl-phosphate reductase n=1 Tax=Glycine max RepID=I1ND31_SOYBN	SoyBase	E_val: 1.00E-86	ISS

Expression Patterns of Glyma15g21180

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g21180 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g21180

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g21180

Limit To All Plant Sequences

>Glyma15g21180.1   sequence type=CDS   gene model=Glyma15g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAAAAGCTATATACGGATTGACAGAGGTTTTAACAGAGGAAATAAAGAATGCACGTCTAGTTGCTAATCCTGGTTGTTATCCAACTTCTGTTCAACTTCCTCTTGTCCCATTCATAAAGGCTAGTCTTATTGAGCTTAAAAATATTATCATTGATGCTAAATCTGGTGTGAGTGGAGCAGGACGTAGTGCCAAAGAAAATTTATTGTTCACTGAAGTAACTGAAGGTCTCAATTCTTATGTCAATTTATGGTTTATCTTGATTCATGGTTTATTGCTTTATCATGCCTGTTTCATAGGGCTGTGGAATGATGAAGAATTTGTTGTTATGTTGGAAAATGGAGCCATTCCTCAAACTCATAGTGTTAAAAGGACTAATTACGGTTTAATCAATGTTTTTCTAGATCAAATTCCTGGAAGAGCAATCATTATATCTGTTATTGATAATTTAGTGAAGGGAGCTTCAGGTCAAGCTTTACAAAACCTTAATTTGTTAATGGGATTTCCAAAAAATTTGGGACTTCATTACCTGCCTCTTTTTCCT

Predicted protein sequences of Glyma15g21180

Limit To All Plant Sequences

>Glyma15g21180.1   sequence type=predicted peptide   gene model=Glyma15g21180   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KKAIYGLTEVLTEEIKNARLVANPGCYPTSVQLPLVPFIKASLIELKNIIIDAKSGVSGAGRSAKENLLFTEVTEGLNSYVNLWFILIHGLLLYHACFIGLWNDEEFVVMLENGAIPQTHSVKRTNYGLINVFLDQIPGRAIIISVIDNLVKGASGQALQNLNLLMGFPKNLGLHYLPLFP

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain