SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g21061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g21061): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g21061

Feature Type:gene_model
Chromosome:Gm15
Start:19261094
stop:19263114
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16570AT Annotation by Michelle Graham. TAIR10: glutamine synthetase 1;4 | chr5:5421898-5424523 REVERSE LENGTH=356 SoyBaseE_val: 3.00E-49ISS
GO:0006542GO-bp Annotation by Michelle Graham. GO Biological Process: glutamine biosynthetic process SoyBaseN/AISS
GO:0006807GO-bp Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0042128GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate assimilation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004356GO-mf Annotation by Michelle Graham. GO Molecular Function: glutamate-ammonia ligase activity SoyBaseN/AISS
PTHR20852Panther GLUTAMINE SYNTHETASE JGI ISS
PTHR20852:SF14Panther GLUTAMINE SYNTHETASE (GLUTAMATE--AMMONIA LIGASE) ( JGI ISS
PF00120PFAM Glutamine synthetase, catalytic domain JGI ISS
UniRef100_O82560UniRef Annotation by Michelle Graham. Best UniRef hit: Glutamine synthetase cytosolic isozyme 2 n=2 Tax=Glycine max RepID=GLNA2_SOYBN SoyBaseE_val: 2.00E-52ISS
UniRef100_O82560UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamine synthetase cytosolic isozyme 2 n=2 Tax=Glycine max RepID=GLNA2_SOYBN SoyBaseE_val: 2.00E-52ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g21061 not represented in the dataset

Glyma15g21061 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g186600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g21061.1   sequence type=CDS   gene model=Glyma15g21061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATATGAGGAGCAAAGGAAGGGTAGTTTACTTCACCTTTTTGTATGGCCTAGAGCAAGAATACACCTTGTTGCAAAAAGATGTCCAATGGCTTCTAGGATGGCCTCTTGGTGGTTTTCCTGGGCTACAAGCTTTCGGGCGTGATATTGTCGACTCACATTACAAAGCATGTATTTATGCGGGCATTAACATAAGTGGAATCAATGGAGAAATGATGGGTGGTCAGAGGATCACCAAGATTGCAAGAGTGGTGCTTTCCTTTGACCCTAAACCAATTCAGGGTGATTGGAATGATGCTGGTGCTCACACAAATTATTACAGTACCAAGTCCATGAGAAACGATGGTGGCTATGAAGTCATCAGCAATTGCTAA

>Glyma15g21061.1   sequence type=predicted peptide   gene model=Glyma15g21061   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDMRSKGRVVYFTFLYGLEQEYTLLQKDVQWLLGWPLGGFPGLQAFGRDIVDSHYKACIYAGINISGINGEMMGGQRITKIARVVLSFDPKPIQGDWNDAGAHTNYYSTKSMRNDGGYEVISNC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo