SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20680

Feature Type:gene_model
Chromosome:Gm15
Start:18577668
stop:18581063
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20680
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48350AT Annotation by Michelle Graham. TAIR10: Ribosomal L18p/L5e family protein | chr1:17867269-17868215 FORWARD LENGTH=170 SoyBaseE_val: 1.00E-68ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PF00861PFAM Ribosomal L18p/L5e family JGI ISS
UniRef100_A2Q3Y9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L18 n=1 Tax=Medicago truncatula RepID=A2Q3Y9_MEDTR SoyBaseE_val: 1.00E-77ISS
UniRef100_I1MHM0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHM0_SOYBN SoyBaseE_val: 6.00E-115ISS

Expression Patterns of Glyma15g20680
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g20680
ParalogEvidenceComments
Glyma09g09110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g20680 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g185000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20680
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20680
>Glyma15g20680.1   sequence type=CDS   gene model=Glyma15g20680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGCTTCTTCGCTCTCCTTCCTCCATTCTTGCACATCCCCCTCTTCCTCTTCCTTATTGTCAATTTCACCTCCAAACCCCAAACCCTCTCACTTCCTACCTTTCGTGGTCGAAGCCAAAGACAGGACCCGCAGGGAAGACAGGACCGCTCGCCACACTCGCATCAGAAAGAAGGTCGAAGGGACGCCCGAGAGGCCGAGGCTGTCCGTGTTCCGGTCGAACAAGCATCTCTCTGTGCAGGTGATTGATGACACCGCAATGCGCACGCTTGCTTCGGTGTCGACAATGCAGAAGACGGTTGCTGATGAGTTCAACTACTCCGCTGGCCCTACAGTTGAAGTAGCAAAGAGGATGGGTGAGATCATTGCAAAATCCTGTTTGGAGAAGGGGATCACAAAGGTTGCCTTTGATCGAGGTGGATACCCATACCATGGCCGTGTTCAAGCACTTGCTGAAGCAGCCCGTGAACATGGCCTAGATTTCTAA
Predicted protein sequences of Glyma15g20680
>Glyma15g20680.1   sequence type=predicted peptide   gene model=Glyma15g20680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLASSLSFLHSCTSPSSSSLLSISPPNPKPSHFLPFVVEAKDRTRREDRTARHTRIRKKVEGTPERPRLSVFRSNKHLSVQVIDDTAMRTLASVSTMQKTVADEFNYSAGPTVEVAKRMGEIIAKSCLEKGITKVAFDRGGYPYHGRVQALAEAAREHGLDF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo