SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20491

Feature Type:gene_model
Chromosome:Gm15
Start:18337589
stop:18338525
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20491
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40580AT Annotation by Michelle Graham. TAIR10: 20S proteasome beta subunit PBB2 | chr5:16248511-16250451 REVERSE LENGTH=268 SoyBaseE_val: 2.00E-34ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051603GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005839GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex SoyBaseN/AISS
GO:0004175GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity SoyBaseN/AISS
GO:0004298GO-mf Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity SoyBaseN/AISS
GO:0008233GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidase activity SoyBaseN/AISS
PTHR11599Panther PROTEASOME SUBUNIT ALPHA/BETA JGI ISS
PTHR11599:SF1Panther PROTEASOME BETA SUBUNIT JGI ISS
UniRef100_I1JJI4UniRef Annotation by Michelle Graham. Best UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=I1JJI4_SOYBN SoyBaseE_val: 1.00E-39ISS
UniRef100_I1JJI4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=I1JJI4_SOYBN SoyBaseE_val: 1.00E-39ISS

Expression Patterns of Glyma15g20491
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20491 not represented in the dataset
Glyma15g20491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20491 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g184000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20491
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20491
>Glyma15g20491.1   sequence type=CDS   gene model=Glyma15g20491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACTAACACCCTCCCATTTGCTACAATGGGATCAGGTTCACTTGCTGCAATGTCTGTATTTGAGTCTAAGTACAAGGAAAGTTTGAGTGTAAGTAATATATTTAATGATCGAGGAAGTGGAAGTAATGTTGATGTTTGTGTGATAACCAAGGGACATAAGGAATATCTCAGGAACCACCTTCTACTAAATCCTCATACCTATGTCAATCCAAAAGGCTTTGATTTCCCCAAAAAGATAGGTTAG
Predicted protein sequences of Glyma15g20491
>Glyma15g20491.1   sequence type=predicted peptide   gene model=Glyma15g20491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTNTLPFATMGSGSLAAMSVFESKYKESLSVSNIFNDRGSGSNVDVCVITKGHKEYLRNHLLLNPHTYVNPKGFDFPKKIG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo