SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20481

Feature Type:gene_model
Chromosome:Gm15
Start:18336075
stop:18336364
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20481
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20140AT Annotation by Michelle Graham. TAIR10: AAA-type ATPase family protein | chr2:8692736-8694837 FORWARD LENGTH=443 SoyBaseE_val: 2.00E-42ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0007292GO-bp Annotation by Michelle Graham. GO Biological Process: female gamete generation SoyBaseN/AISS
GO:0010078GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of root meristem identity SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0048232GO-bp Annotation by Michelle Graham. GO Biological Process: male gamete generation SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR23073Panther 26S PROTEASE REGULATORY SUBUNIT JGI ISS
PTHR23073:SF9Panther 26S PROTEASE REGULATORY SUBUNIT 4 JGI ISS
UniRef100_B9S579UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit, putative n=1 Tax=Ricinus communis RepID=B9S579_RICCO SoyBaseE_val: 2.00E-40ISS
UniRef100_UPI000233BA5FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BA5F related cluster n=1 Tax=unknown RepID=UPI000233BA5F SoyBaseE_val: 2.00E-50ISS

Expression Patterns of Glyma15g20481
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20481 not represented in the dataset
Glyma15g20481 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20481 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g183900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20481
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20481
>Glyma15g20481.1   sequence type=CDS   gene model=Glyma15g20481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAACCAGGAGAGGCTGAAGCCGCAGAAGGAGAAGGCCAAGGAAGACAGATCAAAGGTCGATGATCTTCAAGGTTCTCCTATGAGCGTTGGTAACCTCGAGGAACTCATTGACGAGAGTCATGCCATAGTTTCATCCTCGATGGGGCCCGAGTACTATGTTGGTATGTTGTCTTTCATCGATAAGGATCAGCTCGAGCCTGAATGCGCTATTTTGATGCATAACAAGGTAGGGTTAGGGTATGCTGCTGATTTGTTGAATTGTTTTAGCATTTTGATTGATTGA
Predicted protein sequences of Glyma15g20481
>Glyma15g20481.1   sequence type=predicted peptide   gene model=Glyma15g20481   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANQERLKPQKEKAKEDRSKVDDLQGSPMSVGNLEELIDESHAIVSSSMGPEYYVGMLSFIDKDQLEPECAILMHNKVGLGYAADLLNCFSILID*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo