SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20441

Feature Type:gene_model
Chromosome:Gm15
Start:18295769
stop:18296193
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20441
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25500AT Annotation by Michelle Graham. TAIR10: formin homology 1 | chr3:9251320-9254826 REVERSE LENGTH=1051 SoyBaseE_val: 2.00E-29ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0009825GO-bp Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010817GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels SoyBaseN/AISS
GO:0030036GO-bp Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization SoyBaseN/AISS
GO:0043481GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051016GO-bp Annotation by Michelle Graham. GO Biological Process: barbed-end actin filament capping SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0051015GO-mf Annotation by Michelle Graham. GO Molecular Function: actin filament binding SoyBaseN/AISS
PTHR23213Panther FORMIN-RELATED JGI ISS
PF02181PFAM Formin Homology 2 Domain JGI ISS
UniRef100_G7JPP8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Formin-like protein n=1 Tax=Medicago truncatula RepID=G7JPP8_MEDTR SoyBaseE_val: 2.00E-29ISS
UniRef100_UPI000233BA5BUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BA5B related cluster n=1 Tax=unknown RepID=UPI000233BA5B SoyBaseE_val: 6.00E-35ISS

Expression Patterns of Glyma15g20441
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20441 not represented in the dataset
Glyma15g20441 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20441 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g183600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20441
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20441
>Glyma15g20441.1   sequence type=CDS   gene model=Glyma15g20441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCAACTAAAGAAGAAGAATCAAAGCTGAAGGAGTTTCAAGATGAATCGCCCTTCAAGCTTGGCCTGGCTGAGAAATTTCTTAAAGTCGTGCTTGATATACCTTTTGCTTTTAAGAGAGTGGATGCTATGCTCTACATTGCAAAATTTGATTCTGAATTAGAATACCTTAAGAAGTCCTTTGAAACTCTGGAGGTATATATATTCTGA
Predicted protein sequences of Glyma15g20441
>Glyma15g20441.1   sequence type=predicted peptide   gene model=Glyma15g20441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPTKEEESKLKEFQDESPFKLGLAEKFLKVVLDIPFAFKRVDAMLYIAKFDSELEYLKKSFETLEVYIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo