SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20385

Feature Type:gene_model
Chromosome:Gm15
Start:18188308
stop:18188674
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20385
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00700AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein N | chrC:74249-74380 REVERSE LENGTH=43 SoyBaseE_val: 4.00E-23ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009539GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II reaction center SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
PF02468PFAM Photosystem II reaction centre N protein (psbN) JGI ISS
UniRef100_Q2PMQ7UniRef Annotation by Michelle Graham. Best UniRef hit: Protein PsbN n=1 Tax=Glycine max RepID=PSBN_SOYBN SoyBaseE_val: 2.00E-22ISS
UniRef100_Q2PMQ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein PsbN n=1 Tax=Glycine max RepID=PSBN_SOYBN SoyBaseE_val: 2.00E-22ISS

Expression Patterns of Glyma15g20385
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20385 not represented in the dataset
Glyma15g20385 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20385 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g188400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20385
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20385
>Glyma15g20385.1   sequence type=CDS   gene model=Glyma15g20385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAACAGCAACCCTAATTGCCATCTCTATATCTGGTTTACTTGTAAGTTTTACTGGGTATGCCTTATATATTGCCTTTGGGCAACCCTCGCAACAACTAAGAGATCCATTTGAAGAACATGGGGACTAG
Predicted protein sequences of Glyma15g20385
>Glyma15g20385.1   sequence type=predicted peptide   gene model=Glyma15g20385   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METATLIAISISGLLVSFTGYALYIAFGQPSQQLRDPFEEHGD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo