SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20310

Feature Type:gene_model
Chromosome:Gm15
Start:18129319
stop:18130227
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G33610AT Annotation by Michelle Graham. TAIR10: switch subunit 3 | chr2:14229023-14231149 FORWARD LENGTH=469 SoyBaseE_val: 6.00E-21ISS
GO:0006338GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin remodeling SoyBaseN/AISS
GO:0040029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016514GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SWI/SNF complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12802Panther SWI/SNF COMPLEX-RELATED JGI ISS
PTHR12802:SF2Panther gb def: putative transcriptional regulatory protein [arabidopsis thaliana] JGI ISS
UniRef100_G7J6G8UniRef Annotation by Michelle Graham. Most informative UniRef hit: SWI/SNF complex subunit SMARCC2 n=1 Tax=Medicago truncatula RepID=G7J6G8_MEDTR SoyBaseE_val: 1.00E-43ISS
UniRef100_I1JSR2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSR2_SOYBN SoyBaseE_val: 2.00E-55ISS

Expression Patterns of Glyma15g20310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g20310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g20310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20310
>Glyma15g20310.1   sequence type=CDS   gene model=Glyma15g20310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTGCTTTCCTGTCTGCTTTGGCTGGGTTAGAGGTTGCACAAGCTGCTGCTCAAGCTGCATTGACAACTCTGTCTGAGGTTTACAAAGCAACTAAAATAAATTATCGGGCGTTTCCAAGGAATACATTGCTGCAAGTAGAATTGTGGCTTTATGTTTTATGCAGATGCTGGTATCACCTTGAGAAGGAAGAGTTAGATGTGGAAAACGCAATTTCTGAGATTATAGAAGTTCAAATGAAAAATATCCAAGATAAGCTTGTTCATTTTGAAGATTTGGACCTGCTGATGGAAAAAGAAGGCCAGCAGATGGAGCAAATGAAAAATATGTTTTTTCTTGATCAGCTTACTCTTTTATTTCATAAATCATCTGCACCAAAAACTGGAGAATGA
Predicted protein sequences of Glyma15g20310
>Glyma15g20310.1   sequence type=predicted peptide   gene model=Glyma15g20310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TAFLSALAGLEVAQAAAQAALTTLSEVYKATKINYRAFPRNTLLQVELWLYVLCRCWYHLEKEELDVENAISEIIEVQMKNIQDKLVHFEDLDLLMEKEGQQMEQMKNMFFLDQLTLLFHKSSAPKTGE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo