|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G33610 | AT | Annotation by Michelle Graham. TAIR10: switch subunit 3 | chr2:14229023-14231149 FORWARD LENGTH=469 | SoyBase | E_val: 6.00E-21 | ISS |
| GO:0006338 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin remodeling | SoyBase | N/A | ISS |
| GO:0040029 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of gene expression, epigenetic | SoyBase | N/A | ISS |
| GO:0048573 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0016514 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: SWI/SNF complex | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR12802 | Panther | SWI/SNF COMPLEX-RELATED | JGI | ISS | |
| PTHR12802:SF2 | Panther | gb def: putative transcriptional regulatory protein [arabidopsis thaliana] | JGI | ISS | |
| UniRef100_G7J6G8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: SWI/SNF complex subunit SMARCC2 n=1 Tax=Medicago truncatula RepID=G7J6G8_MEDTR | SoyBase | E_val: 1.00E-43 | ISS |
| UniRef100_I1JSR2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JSR2_SOYBN | SoyBase | E_val: 2.00E-55 | ISS |
|
Glyma15g20310 not represented in the dataset |
Glyma15g20310 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g20310.1 sequence type=CDS gene model=Glyma15g20310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ACTGCTTTCCTGTCTGCTTTGGCTGGGTTAGAGGTTGCACAAGCTGCTGCTCAAGCTGCATTGACAACTCTGTCTGAGGTTTACAAAGCAACTAAAATAAATTATCGGGCGTTTCCAAGGAATACATTGCTGCAAGTAGAATTGTGGCTTTATGTTTTATGCAGATGCTGGTATCACCTTGAGAAGGAAGAGTTAGATGTGGAAAACGCAATTTCTGAGATTATAGAAGTTCAAATGAAAAATATCCAAGATAAGCTTGTTCATTTTGAAGATTTGGACCTGCTGATGGAAAAAGAAGGCCAGCAGATGGAGCAAATGAAAAATATGTTTTTTCTTGATCAGCTTACTCTTTTATTTCATAAATCATCTGCACCAAAAACTGGAGAATGA
>Glyma15g20310.1 sequence type=predicted peptide gene model=Glyma15g20310 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TAFLSALAGLEVAQAAAQAALTTLSEVYKATKINYRAFPRNTLLQVELWLYVLCRCWYHLEKEELDVENAISEIIEVQMKNIQDKLVHFEDLDLLMEKEGQQMEQMKNMFFLDQLTLLFHKSSAPKTGE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||