SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g20160

Feature Type:gene_model
Chromosome:Gm15
Start:17902217
stop:17905404
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20810AT Annotation by Michelle Graham. TAIR10: SAUR-like auxin-responsive protein family | chr5:7044791-7045555 FORWARD LENGTH=165 SoyBaseE_val: 2.00E-54ISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
PF02519PFAM Auxin responsive protein JGI ISS
UniRef100_I1MHJ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHJ5_SOYBN SoyBaseE_val: 1.00E-95ISS
UniRef100_Q8H6T6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin-regulated protein n=1 Tax=Phaseolus vulgaris RepID=Q8H6T6_PHAVU SoyBaseE_val: 8.00E-59ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g08480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g20160.1   sequence type=CDS   gene model=Glyma15g20160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAGCGATGGAGGCTCCAAATTGACTGGGATTAGGCAGATTGTGAAGATAAAGGAAATGCTCCAGAAGTGGCAAAGTGTGACATTAGGCCCAAAACCTTGCAATTCCCTTTCTGATCATGTGGCTAATGATGATGGAAGCATATCACCATTGATCAACAAAAGGGTAGTGAATGTGATATCGGACAACGAAGACAGTTGCCAAAGTCCTGCAGAACCGCTTCCGCCAGCTGATGTTCCAAAAGGGAGGTTCATCATTCCCACCAGCTACCTTAGCCACTCTCTCTTCATAGTTTTGCTGGAAAAGGCTGCAGAGGAATTCGGGTTTGATCAGAGTGGTGGCCTCACCATCCCATGTGAGATTGAGACCTTCAAGTACCTGCTCAAGTGCATGGAGAATGAGCAGAAAGAGCAACTCGGTGACAGTGCCCCTGGAAGCTCAAGGACTGTGGAAGAGTAA

>Glyma15g20160.1   sequence type=predicted peptide   gene model=Glyma15g20160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSDGGSKLTGIRQIVKIKEMLQKWQSVTLGPKPCNSLSDHVANDDGSISPLINKRVVNVISDNEDSCQSPAEPLPPADVPKGRFIIPTSYLSHSLFIVLLEKAAEEFGFDQSGGLTIPCEIETFKYLLKCMENEQKEQLGDSAPGSSRTVEE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo