SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g20060

Feature Type:gene_model
Chromosome:Gm15
Start:17689334
stop:17690861
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g20060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20740AT Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein | chr5:7025867-7026484 REVERSE LENGTH=205 SoyBaseE_val: 5.00E-54ISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004857GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity SoyBaseN/AISS
GO:0030599GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity SoyBaseN/AISS
GO:0046910GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity SoyBaseN/AISS
PF04043PFAM Plant invertase/pectin methylesterase inhibitor JGI ISS
UniRef100_B9RR57UniRef Annotation by Michelle Graham. Most informative UniRef hit: 21 kDa protein, putative n=1 Tax=Ricinus communis RepID=B9RR57_RICCO SoyBaseE_val: 2.00E-68ISS
UniRef100_UPI000189DA49UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189DA49 related cluster n=1 Tax=unknown RepID=UPI000189DA49 SoyBaseE_val: 8.00E-155ISS

Expression Patterns of Glyma15g20060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g20060
ParalogEvidenceComments
Glyma09g08410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g20060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g181600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g20060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g20060
>Glyma15g20060.1   sequence type=CDS   gene model=Glyma15g20060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACTCCAACCCACTCTCTCCACTCTCTACCTCTCCCTTTTGTTAACAATAACGTTAACATCTCCAACCTTGGCAGCACAAAGCAAGCCGCAGGATCTGGTCCGGTCCTCGTGCGTGCACGCGCGGTACCCGCGTCTGTGCCTGCGCACCCTCTCGAACTACCCGGGTCCCGCCAACACGCCGTTAGACGTGGCCAGGGCAGCTTTGAGGGTAAGCCTGGCCCACACGCGCCGGGCCTCCAAATTCCTCCATGCACTTTCTCATGGAGGCGCTGCCGCCATGAGCAAGCGCCAGCGCTCCGCGCTGCGCGACTGTAATGAACAGATTTCGGACTCCGTCGACCAGCTGCGGCGGAGCCTCGACGAGCTGCAGCACCTGCGCTCCGAGACGTTCAAGTGGCAGATGAGCAACGCCCTGACTTGGGTCAGCGCCGCCCTCACCAACGGCGACACCTGCCTCGACGGCTTCGGAGGGAATGCCAGGCCCGACGTCAAACGCAGAGTCACGGATGTGGCGAGGGTTACTAGCAATGCTTTGTATATGATTAATCGGCTCGGGCAAAGTAGAACCGGGAAGCCCAAGCCCAAACCCAAACCCAGGTCCAGGCCTCAGCCTCGCTCTGCCTCAAGTACTGAAAAATTGAATTAG
Predicted protein sequences of Glyma15g20060
>Glyma15g20060.1   sequence type=predicted peptide   gene model=Glyma15g20060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLQPTLSTLYLSLLLTITLTSPTLAAQSKPQDLVRSSCVHARYPRLCLRTLSNYPGPANTPLDVARAALRVSLAHTRRASKFLHALSHGGAAAMSKRQRSALRDCNEQISDSVDQLRRSLDELQHLRSETFKWQMSNALTWVSAALTNGDTCLDGFGGNARPDVKRRVTDVARVTSNALYMINRLGQSRTGKPKPKPKPRSRPQPRSASSTEKLN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo