Report for Sequence Feature Glyma15g20060
Feature Type: gene_model
Chromosome: Gm15
Start: 17689334
stop: 17690861
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g20060
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G20740 AT
Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein | chr5:7025867-7026484 REVERSE LENGTH=205
SoyBase E_val: 5.00E-54 ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0004857 GO-mf
Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity
SoyBase N/A ISS
GO:0030599 GO-mf
Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity
SoyBase N/A ISS
GO:0046910 GO-mf
Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity
SoyBase N/A ISS
PF04043 PFAM
Plant invertase/pectin methylesterase inhibitor
JGI ISS
UniRef100_B9RR57 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 21 kDa protein, putative n=1 Tax=Ricinus communis RepID=B9RR57_RICCO
SoyBase E_val: 2.00E-68 ISS
UniRef100_UPI000189DA49 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000189DA49 related cluster n=1 Tax=unknown RepID=UPI000189DA49
SoyBase E_val: 8.00E-155 ISS
Expression Patterns of Glyma15g20060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g20060
Paralog Evidence Comments
Glyma09g08410 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g20060 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g181600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g20060
Coding sequences of Glyma15g20060
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g20060.1 sequence type=CDS gene model=Glyma15g20060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCAACTCCAACCCACTCTCTCCACTCTCTACCTCTCCCTTTTGTTAACAATAACGTTAACATCTCCAACCTTGGCAGCACAAAGCAAGCCGCAGGATCTGGTCCGGTCCTCGTGCGTGCACGCGCGGTACCCGCGTCTGTGCCTGCGCACCCTCTCGAACTACCCGGGTCCCGCCAACACGCCGTTAGACGTGGCCAGGGCAGCTTTGAGGGTAAGCCTGGCCCACACGCGCCGGGCCTCCAAATTCCTCCATGCACTTTCTCATGGAGGCGCTGCCGCCATGAGCAAGCGCCAGCGCTCCGCGCTGCGCGACTGTAATGAACAGATTTCGGACTCCGTCGACCAGCTGCGGCGGAGCCTCGACGAGCTGCAGCACCTGCGCTCCGAGACGTTCAAGTGGCAGATGAGCAACGCCCTGACTTGGGTCAGCGCCGCCCTCACCAACGGCGACACCTGCCTCGACGGCTTCGGAGGGAATGCCAGGCCCGACGTCAAACGCAGAGTCACGGATGTGGCGAGGGTTACTAGCAATGCTTTGTATATGATTAATCGGCTCGGGCAAAGTAGAACCGGGAAGCCCAAGCCCAAACCCAAACCCAGGTCCAGGCCTCAGCCTCGCTCTGCCTCAAGTACTGAAAAATTGAATTAG
Predicted protein sequences of Glyma15g20060
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g20060.1 sequence type=predicted peptide gene model=Glyma15g20060 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MQLQPTLSTLYLSLLLTITLTSPTLAAQSKPQDLVRSSCVHARYPRLCLRTLSNYPGPANTPLDVARAALRVSLAHTRRASKFLHALSHGGAAAMSKRQRSALRDCNEQISDSVDQLRRSLDELQHLRSETFKWQMSNALTWVSAALTNGDTCLDGFGGNARPDVKRRVTDVARVTSNALYMINRLGQSRTGKPKPKPKPRSRPQPRSASSTEKLN*