SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g20045

Feature Type:gene_model
Chromosome:Gm15
Start:17668716
stop:17670845
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G74960AT Annotation by Michelle Graham. TAIR10: fatty acid biosynthesis 1 | chr1:28152564-28155948 REVERSE LENGTH=541 SoyBaseE_val: 9.00E-39ISS
GO:0000038GO-bp Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process SoyBaseN/AISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006633GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009631GO-bp Annotation by Michelle Graham. GO Biological Process: cold acclimation SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0015994GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll metabolic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019216GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of lipid metabolic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0031408GO-bp Annotation by Michelle Graham. GO Biological Process: oxylipin biosynthetic process SoyBaseN/AISS
GO:0042335GO-bp Annotation by Michelle Graham. GO Biological Process: cuticle development SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004312GO-mf Annotation by Michelle Graham. GO Molecular Function: fatty acid synthase activity SoyBaseN/AISS
GO:0004315GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-oxoacyl-[acyl-carrier-protein] synthase activity SoyBaseN/AISS
GO:0016747GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups SoyBaseN/AISS
PTHR11712Panther POLYKETIDE SYNTHASE-RELATED JGI ISS
PTHR11712:SF52Panther SUBFAMILY NOT NAMED JGI ISS
PF02801PFAM Beta-ketoacyl synthase, C-terminal domain JGI ISS
UniRef100_D8KXZ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-ketoacyl-ACP synthase II-1 n=1 Tax=Arachis hypogaea RepID=D8KXZ0_ARAHY SoyBaseE_val: 4.00E-45ISS
UniRef100_UPI000233BA4CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BA4C related cluster n=1 Tax=unknown RepID=UPI000233BA4C SoyBaseE_val: 9.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g20045 not represented in the dataset

Glyma15g20045 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g20045.2   sequence type=transcript   gene model=Glyma15g20045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGTAAACTTCAACAAGCTAAGAGTGAATTCAACGAAATCTATGATCGGTCACCTACTAGGGGCAGCTGGTGGTGTGGAAGCCGTAGCAACAATACAGGCAATAAAGACAGGGTGGGTTCATCCCAATATCAATTTAGAAAACCCAGATGAAGGAGTGAATAACCAGACAATGTATTGGATACTCACACTACTCCTTTGGTTGAACAAAAATGATTATAGGGGGGATTGCTTTCTTGGATGATCACTTATGTTCAAAAACATTGAAGTAATCCTCTAGAATCAATATTTCTAGACTTGTTTGTTCAAGGTTTTAGTGTCTATATAGTCATTGATGAAAAATAACACTTGATGGGACATAGACATTGTTTTATTTCCATGTACGAAATGGCCATATAGTAGACACAACAATTTTAATGCTTAGAGTTAGATAGCATTTTCATTTAAATTTATGCCATTGAATTTAATGACAATTTTGTCTTTTTC

>Glyma15g20045.1   sequence type=CDS   gene model=Glyma15g20045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGTAAACTTCAACAAGCTAAGAGTGAATTCAACGAAATCTATGATCGGTCACCTACTAGGGGCAGCTGGTGGTGTGGAAGCCGTAGCAACAATACAGGCAATAAAGACAGGGTGGGTTCATCCCAATATCAATTTAGAAAACCCAGATGAAGGAGTGGATACCAATGTTCTTGTCGGCTCTAAGAAAGAGACACTAGATATCAAGGCGGCCATGTCTAATTCATTCGGCTTTGGTGGCCAAAATTCCTCTATCATATTTGCCCCTTTCAAATGCAATAGATTTTAG

>Glyma15g20045.2   sequence type=CDS   gene model=Glyma15g20045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATGTAAACTTCAACAAGCTAAGAGTGAATTCAACGAAATCTATGATCGGTCACCTACTAGGGGCAGCTGGTGGTGTGGAAGCCGTAGCAACAATACAGGCAATAAAGACAGGGTGGGTTCATCCCAATATCAATTTAGAAAACCCAGATGAAGGAGTGAATAACCAGACAATGTATTGGATACTCACACTACTCCTTTGGTTGAACAAAAATGATTATAGGGGGGATTGCTTTCTTGGATGA

>Glyma15g20045.1   sequence type=predicted peptide   gene model=Glyma15g20045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNVNFNKLRVNSTKSMIGHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGVDTNVLVGSKKETLDIKAAMSNSFGFGGQNSSIIFAPFKCNRF*

>Glyma15g20045.2   sequence type=predicted peptide   gene model=Glyma15g20045   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNVNFNKLRVNSTKSMIGHLLGAAGGVEAVATIQAIKTGWVHPNINLENPDEGVNNQTMYWILTLLLWLNKNDYRGDCFLG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo