SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19940

Feature Type:gene_model
Chromosome:Gm15
Start:17429766
stop:17430900
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19940
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09640AT Annotation by Michelle Graham. TAIR10: ascorbate peroxidase 2 | chr3:2956301-2958163 FORWARD LENGTH=251 SoyBaseE_val: 3.00E-18ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004601GO-mf Annotation by Michelle Graham. GO Molecular Function: peroxidase activity SoyBaseN/AISS
GO:0016688GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ascorbate peroxidase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PF00141PFAM Peroxidase JGI ISS
UniRef100_I1K1Y4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1Y4_SOYBN SoyBaseE_val: 2.00E-23ISS
UniRef100_Q43758UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ascorbate peroxidase n=1 Tax=Glycine max RepID=Q43758_SOYBN SoyBaseE_val: 3.00E-19ISS

Expression Patterns of Glyma15g19940
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19940 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g180400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19940
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19940
>Glyma15g19940.1   sequence type=CDS   gene model=Glyma15g19940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGATTGATGTTTTGGAGATGCTGGTGCGCATGGACCCATCGGACATCGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACCCGTTGGCTAGCGTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTAGAAGAGAGCCTGGGTGTTGCTGGATGGAGAGTTTTGCCCCAAAAAATTTCAATTTTTTAGAACAAGCACATTCACGGGTACTTGAGATTCAACATTTTCCCCCCTAA
Predicted protein sequences of Glyma15g19940
>Glyma15g19940.1   sequence type=predicted peptide   gene model=Glyma15g19940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VIDVLEMLVRMDPSDIAIRLLEPLKAEFPILSYADFYPLASVVAVEVTGGPEVPFHPRREPGCCWMESFAPKNFNFLEQAHSRVLEIQHFPP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo