SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19931

Feature Type:gene_model
Chromosome:Gm15
Start:17427346
stop:17428986
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19931
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23250AT Annotation by Michelle Graham. TAIR10: myb domain protein 15 | chr3:8309492-8310624 FORWARD LENGTH=285 SoyBaseE_val: 1.00E-18ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0052542GO-bp Annotation by Michelle Graham. GO Biological Process: defense response by callose deposition SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR10641Panther MYB-RELATED JGI ISS
UniRef100_B9RHL8UniRef Annotation by Michelle Graham. Most informative UniRef hit: R2r3-myb transcription factor, putative n=1 Tax=Ricinus communis RepID=B9RHL8_RICCO SoyBaseE_val: 1.00E-19ISS
UniRef100_UPI0002339B8CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339B8C related cluster n=1 Tax=unknown RepID=UPI0002339B8C SoyBaseE_val: 6.00E-23ISS

Expression Patterns of Glyma15g19931
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g19931 not represented in the dataset
Glyma15g19931 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19931 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g180300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19931
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma15g19931
>Glyma15g19931.2   sequence type=transcript   gene model=Glyma15g19931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGGAAATGGAACTTACCAAATAGTTTGGTCAGAAACAAATTAAGTATGTGAGAGTATGTACCATCAATATAGTCGCCAATGTGGCTTTCAATTTTTCTTCTTCTCTGTTTTCAAGGTCTTGCGAGATGTGGAAAGAGTCGCAGACTAAGGTGGCTGAATTACCTAAGGCCAAACCTCAAAAGAGGAAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACCGACATCTGGGTAATAGGCAATAGGTACATACCATTTTATGTGAGTTCGTTGCCCTGCTTGATATTGTTGGTTCTGCTTCTCCAGCATAGATATGATTTATTTGTTAAGAATGTAATGGATTTAAACTTTCCAATTCAAAGTTAGTTTTCAAGTTTATGATTGGGTGAGTGA
Coding sequences of Glyma15g19931
>Glyma15g19931.1   sequence type=CDS   gene model=Glyma15g19931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCTTTCAATTTTTCTTCTTCTCTGTTTTCAAGGTCTTGCGAGATGTGGAAAGAGTCGCAGACTAAGGTGGCTGAATTACCTAAGGCCAAACCTCAAAAGAGGAAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACCGACATCTGGGTAATAGGCAATAG

>Glyma15g19931.2   sequence type=CDS   gene model=Glyma15g19931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCTTTCAATTTTTCTTCTTCTCTGTTTTCAAGGTCTTGCGAGATGTGGAAAGAGTCGCAGACTAAGGTGGCTGAATTACCTAAGGCCAAACCTCAAAAGAGGAAACTACACCAAGGAAGAGGAGGAAACTATTATCAAGCTGCACCGACATCTGGGTAATAGGCAATAG
Predicted protein sequences of Glyma15g19931
>Glyma15g19931.1   sequence type=predicted peptide   gene model=Glyma15g19931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWLSIFLLLCFQGLARCGKSRRLRWLNYLRPNLKRGNYTKEEEETIIKLHRHLGNRQ*

>Glyma15g19931.2   sequence type=predicted peptide   gene model=Glyma15g19931   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWLSIFLLLCFQGLARCGKSRRLRWLNYLRPNLKRGNYTKEEEETIIKLHRHLGNRQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo