Glyma15g19921 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19921

Feature Type:	gene_model
Chromosome:	Gm15
Start:	17419601
stop:	17425898
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g19921

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G26370	AT	Annotation by Michelle Graham. TAIR10: O-fucosyltransferase family protein \| chr3:9656886-9659741 FORWARD LENGTH=557	SoyBase	E_val: 2.00E-26	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
UniRef100_G7J356	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Auxin-independent growth protein n=1 Tax=Medicago truncatula RepID=G7J356_MEDTR	SoyBase	E_val: 9.00E-39	ISS
UniRef100_UPI000233E6F1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E6F1 related cluster n=1 Tax=unknown RepID=UPI000233E6F1	SoyBase	E_val: 2.00E-41	ISS

Expression Patterns of Glyma15g19921

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g19921 not represented in the dataset	Glyma15g19921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19921 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g180200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g19921

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g19921

Limit To All Plant Sequences

>Glyma15g19921.1   sequence type=CDS   gene model=Glyma15g19921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATATGCCAGCACCAACTTTACAAAGAGGCCTGTGCTCCTTCTTCACCGACGACTCTAGGGTTTTGCCTCACAACTCCAGGATCTCTCTTGCTTTCACATTACTTCTTCTTCTCGTTGGTTTAGTCTCCCTTTTCACCATCTTCAATAATCTCAATGCGCCTTACTTGTGTAAAAACGATGGGATTGTTCTTCACTGCCCGTATGTTAAAGAATCACCATCACTTTGGGAAAATCCTTTCTCTTCCACAACATCTTGGAAGCCCTGTGCTGAGCGCCAGGATGGTGTTTTACCAGGTGTCATACCTTCTTTGTTTTATTCAGAGGAAAATAGTGGTTCACGACTTCCTTCAGCACAATCCTATTGTAGAGTTACAGGCAATTCATTGGCTAAAGGGGAGTAA

Predicted protein sequences of Glyma15g19921

Limit To All Plant Sequences

>Glyma15g19921.1   sequence type=predicted peptide   gene model=Glyma15g19921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNMPAPTLQRGLCSFFTDDSRVLPHNSRISLAFTLLLLLVGLVSLFTIFNNLNAPYLCKNDGIVLHCPYVKESPSLWENPFSSTTSWKPCAERQDGVLPGVIPSLFYSEENSGSRLPSAQSYCRVTGNSLAKGE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain