|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G26370 | AT | Annotation by Michelle Graham. TAIR10: O-fucosyltransferase family protein | chr3:9656886-9659741 FORWARD LENGTH=557 | SoyBase | E_val: 2.00E-26 | ISS |
GO:0006084 | GO-bp | Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process | SoyBase | N/A | ISS |
GO:0016126 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process | SoyBase | N/A | ISS |
GO:0016132 | GO-bp | Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process | SoyBase | N/A | ISS |
GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
GO:0016757 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups | SoyBase | N/A | ISS |
UniRef100_G7J356 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin-independent growth protein n=1 Tax=Medicago truncatula RepID=G7J356_MEDTR | SoyBase | E_val: 9.00E-39 | ISS |
UniRef100_UPI000233E6F1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E6F1 related cluster n=1 Tax=unknown RepID=UPI000233E6F1 | SoyBase | E_val: 2.00E-41 | ISS |
Glyma15g19921 not represented in the dataset |
Glyma15g19921 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.15g180200 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g19921.1 sequence type=CDS gene model=Glyma15g19921 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAATATGCCAGCACCAACTTTACAAAGAGGCCTGTGCTCCTTCTTCACCGACGACTCTAGGGTTTTGCCTCACAACTCCAGGATCTCTCTTGCTTTCACATTACTTCTTCTTCTCGTTGGTTTAGTCTCCCTTTTCACCATCTTCAATAATCTCAATGCGCCTTACTTGTGTAAAAACGATGGGATTGTTCTTCACTGCCCGTATGTTAAAGAATCACCATCACTTTGGGAAAATCCTTTCTCTTCCACAACATCTTGGAAGCCCTGTGCTGAGCGCCAGGATGGTGTTTTACCAGGTGTCATACCTTCTTTGTTTTATTCAGAGGAAAATAGTGGTTCACGACTTCCTTCAGCACAATCCTATTGTAGAGTTACAGGCAATTCATTGGCTAAAGGGGAGTAA
>Glyma15g19921.1 sequence type=predicted peptide gene model=Glyma15g19921 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MNMPAPTLQRGLCSFFTDDSRVLPHNSRISLAFTLLLLLVGLVSLFTIFNNLNAPYLCKNDGIVLHCPYVKESPSLWENPFSSTTSWKPCAERQDGVLPGVIPSLFYSEENSGSRLPSAQSYCRVTGNSLAKGE*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||