SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g19910

Feature Type:gene_model
Chromosome:Gm15
Start:17408095
stop:17409289
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19210AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr1:6626973-6627530 REVERSE LENGTH=185 SoyBaseE_val: 3.00E-49ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_G7IIR1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor RAP2-9 n=1 Tax=Medicago truncatula RepID=G7IIR1_MEDTR SoyBaseE_val: 1.00E-70ISS
UniRef100_UPI000189D0E4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D0E4 related cluster n=1 Tax=unknown RepID=UPI000189D0E4 SoyBaseE_val: 3.00E-154ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g08330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g180000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g19910.2   sequence type=CDS   gene model=Glyma15g19910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAGTCGAAGAGCGTGGAGAAACCTGCGGAGGAACAACAACGAGGTGGTGTTTCAGCGTACAGAGGAGTACGGAAGAGGAAGTGGGGGAAGTACGTGTCGGAAATTAGGCTGCCCAACAGCCGTCAAAGGATTTGGTTGGGTTCCTACGACAGCGCCGAAAAGGCGGCGCGTGCATTCGACGCGGCCATGTTCTGCTTACGTGGCAGCGGTGCCAACTTTAATTTCCCGAGCGACCGGCCCAACATCGCTGGCGGGAGGAACATGACGCCCTCGCAGATTCAGATCGCCGCGGCGCGTTTCGCCAATTCGGAGCCCCGAAAGGAGTGTTCGGGTAAACCCGTGGAGTCTTTGACTTCGATTGAGGAAACGACGTCGTTTCCAGTAAATTCGGATACGGATACATCTTCTCCTCTATCAGTAGTGACGATCCAAAACGACACCGAAGTAGCAACCGGGTCGTTTCCGGGTATATTTTCGGGTTTCGGGTCGGGTAATTTCGTCCCCGAATTCTCCGATTTTCCGAGCTTCGATGATTTCGGCCACGATTTCTTCGTGCATGAGCTTCCGGGTTTCGATTACGGAGAAGAGAACTTGGATGGGTTGATAATTCAGGACTCGTTCCTGTGGAATTTCTAA

>Glyma15g19910.2   sequence type=predicted peptide   gene model=Glyma15g19910   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKSKSVEKPAEEQQRGGVSAYRGVRKRKWGKYVSEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGANFNFPSDRPNIAGGRNMTPSQIQIAAARFANSEPRKECSGKPVESLTSIEETTSFPVNSDTDTSSPLSVVTIQNDTEVATGSFPGIFSGFGSGNFVPEFSDFPSFDDFGHDFFVHELPGFDYGEENLDGLIIQDSFLWNF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo