SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19810

Feature Type:gene_model
Chromosome:Gm15
Start:17240772
stop:17243519
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19810
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G19150AT Annotation by Michelle Graham. TAIR10: photosystem I light harvesting complex gene 6 | chr1:6612806-6613799 FORWARD LENGTH=270 SoyBaseE_val: 1.00E-139ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009765GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030076GO-cc Annotation by Michelle Graham. GO Cellular Compartment: light-harvesting complex SoyBaseN/AISS
GO:0016168GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll binding SoyBaseN/AISS
PTHR21649Panther CHLOROPHYLL A/B BINDING PROTEIN JGI ISS
PF00504PFAM Chlorophyll A-B binding protein JGI ISS
UniRef100_G7IIP1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chlorophyll a-b binding protein n=1 Tax=Medicago truncatula RepID=G7IIP1_MEDTR SoyBaseE_val: 2.00E-145ISS
UniRef100_I1MHH7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHH7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma15g19810
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g19810
ParalogEvidenceComments
Glyma09g08260 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g19810 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g179400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19810
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19810
>Glyma15g19810.1   sequence type=CDS   gene model=Glyma15g19810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTAGCACTTTCCTCCACTGCATTGTCAAGCCTTCCAAACAGAGAAATTCGTCAAAAGGGTTTCCCAGACAGAACACCCACATGCTTGAGTTTGACCAGAAGAACAGTTGCATATGCTACAAAAGGGGTCTCAGCTGTCTGTGAGCCACTTCCTCCAGATAGGCCATTGTGGTTCCCTGGTAGCTCACCTCCTGAGTGGCTTGATGGAAGTCTTCCTGGTGATTTCGGTTTTGACCCTCTTGGATTAGGGTCTGATCCAGAGTTGCTAAAGTGGTTTGCTCAAGCAGAACTAATGCATGCAAGATGGGCAATGCTCGCGGTGTTCGGAATTCTCGTACCCGAATTGCTCGAAAAAATCGGTTACATCGAAAACTTCTCTTGGTACGATGCTGGTGCGCGAGAGTATTTCGTGGACCCAACAACATTGTTCGTTGTGCAAATGGGCCTGATGGGCTGGGTGGAAGGCCGAAGATGGGCCGACATGGTCAATCCGGGGAGCGTTGACATTGAGCCCAAAGTGCCACACATTACGAACCCGAAGCCCGATGTTGGGTACCCAGGTGGGCTTTGGTTTGACCCAATGATGTGGGGGAGAGGGTCACCGGAGCCAGTGATGGTTTTGAGGACCAAGGAGATCAAGAATGGAAGACTTGCAATGTTGGCCTTTGTTGGGTTCTGGTTCCAAGCTATTTACACTGGGGAAGGACCCATTGAAAATTTGATGGCACACCTTGCTGATCCTGGTCACTGCAACATTTTCTCGGCTTTCACGCGTTAG
Predicted protein sequences of Glyma15g19810
>Glyma15g19810.1   sequence type=predicted peptide   gene model=Glyma15g19810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALALSSTALSSLPNREIRQKGFPDRTPTCLSLTRRTVAYATKGVSAVCEPLPPDRPLWFPGSSPPEWLDGSLPGDFGFDPLGLGSDPELLKWFAQAELMHARWAMLAVFGILVPELLEKIGYIENFSWYDAGAREYFVDPTTLFVVQMGLMGWVEGRRWADMVNPGSVDIEPKVPHITNPKPDVGYPGGLWFDPMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQAIYTGEGPIENLMAHLADPGHCNIFSAFTR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo