SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19711

Feature Type:gene_model
Chromosome:Gm15
Start:17107289
stop:17107644
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19711
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G27640AT Annotation by Michelle Graham. TAIR10: translation initiation factor 3B1 | chr5:9781207-9784759 REVERSE LENGTH=738 SoyBaseE_val: 6.00E-14ISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005852GO-cc Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 3 complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
UniRef100_G7J950UniRef Annotation by Michelle Graham. Most informative UniRef hit: Eukaryotic translation initiation factor 3 subunit B n=1 Tax=Medicago truncatula RepID=G7J950_MEDTR SoyBaseE_val: 3.00E-20ISS
UniRef100_I1KJQ5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KJQ5_SOYBN SoyBaseE_val: 2.00E-30ISS

Expression Patterns of Glyma15g19711
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g19711 not represented in the dataset
Glyma15g19711 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19711 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g178700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19711
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19711
>Glyma15g19711.1   sequence type=CDS   gene model=Glyma15g19711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGCTACAATCATGGCGGACGTCATGGTAATGAAGGAGATCGAGGACACGGCGCTGCATCTCGACGTCGATCTCTCCATTCTCGATCTCGACGCCATTCGCCTCCCTCCCGACGAAGATTGCGGCATCGTCAGTGATGACGAGGTGGTTTACCAGGAGGAGAATCTCGAGTTTGAGTCTGGATTTGGTAACATCATTGTCGTGGAGGAGAATCTTGAGTTTGAGTCTGGTTTACCAGGAGGAGAATCTTGA
Predicted protein sequences of Glyma15g19711
>Glyma15g19711.1   sequence type=predicted peptide   gene model=Glyma15g19711   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLATIMADVMVMKEIEDTALHLDVDLSILDLDAIRLPPDEDCGIVSDDEVVYQEENLEFESGFGNIIVVEENLEFESGLPGGES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo