SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19690

Feature Type:gene_model
Chromosome:Gm15
Start:17073201
stop:17074876
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19690
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G05830AT Annotation by Michelle Graham. TAIR10: NagB/RpiA/CoA transferase-like superfamily protein | chr2:2230057-2231839 FORWARD LENGTH=326 SoyBaseE_val: 6.00E-101ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006413GO-bp Annotation by Michelle Graham. GO Biological Process: translational initiation SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0019509GO-bp Annotation by Michelle Graham. GO Biological Process: L-methionine salvage from methylthioadenosine SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0044237GO-bp Annotation by Michelle Graham. GO Biological Process: cellular metabolic process SoyBaseN/AISS
GO:0044249GO-bp Annotation by Michelle Graham. GO Biological Process: cellular biosynthetic process SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:0071369GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to ethylene stimulus SoyBaseN/AISS
GO:0071732GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitric oxide SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005851GO-cc Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 2B complex SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0046523GO-mf Annotation by Michelle Graham. GO Molecular Function: S-methyl-5-thioribose-1-phosphate isomerase activity SoyBaseN/AISS
PTHR10233Panther TRANSLATION INITIATION FACTOR EIF-2B JGI ISS
PTHR10233:SF6Panther TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT-RELATED JGI ISS
PF01008PFAM Initiation factor 2 subunit family JGI ISS
UniRef100_G7IGG7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methylthioribose-1-phosphate isomerase n=1 Tax=Medicago truncatula RepID=G7IGG7_MEDTR SoyBaseE_val: 4.00E-117ISS
UniRef100_G7IGG7UniRef Annotation by Michelle Graham. Best UniRef hit: Methylthioribose-1-phosphate isomerase n=1 Tax=Medicago truncatula RepID=G7IGG7_MEDTR SoyBaseE_val: 4.00E-117ISS

Expression Patterns of Glyma15g19690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g19690
ParalogEvidenceComments
Glyma09g08190 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g19690 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g178600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19690
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19690
>Glyma15g19690.2   sequence type=CDS   gene model=Glyma15g19690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATATAGATGCTGCTGAAGTTATGCTTGAGGATGATGTTGCCTCAAATAGAGCTATTGGTTCGTATGGAGCTAGTATTATTCAACATCAAACAGAGAAACAAAAGTTTTCTGTTTTGACTCATTGCAATACTGGAAGTCTAGCCACAGCTGGATATGGTACTGCTCTGGGTGTGATCCGTGCACTTCACAGTGCTGGAGTTCTAGAAAGGGTTTATTGCACAGAAACACGCCCATTCAATCAAGGATCTAGACTCACTGCTTTTGAGTTGGTGCATGAAAAATTATCAGGAACTCTTATTTCCAATTCAATTCTGCTGCAGCTGCAATTAATGAAAGCAGGACATGTGGATGCTGTTGTTGTTGGGGCAGATCGTGTTGCATCAAACGGTGACACAGCCAACAAAATAGGAACCGACAGCGTTGCCTTGTCTGCTAAGTTTCATAATGTACCTTTCTATGAATTGTTGAACACACATGGAGGACTTGGAGAGCAGATTGCTGCCTCAGGAATTTCCGTCTGGAACCCAGCTTTTGATGTTACTCCTGCTAATCTAATATCCGGGATCATCACTGAGAAGGGTGTCGTTACAAAGACAACTGCTGGTGGTGCATTTGACATCAAAGCTTTCGTACAGAAAACTGGTTAA
Predicted protein sequences of Glyma15g19690
>Glyma15g19690.2   sequence type=predicted peptide   gene model=Glyma15g19690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYIDAAEVMLEDDVASNRAIGSYGASIIQHQTEKQKFSVLTHCNTGSLATAGYGTALGVIRALHSAGVLERVYCTETRPFNQGSRLTAFELVHEKLSGTLISNSILLQLQLMKAGHVDAVVVGADRVASNGDTANKIGTDSVALSAKFHNVPFYELLNTHGGLGEQIAASGISVWNPAFDVTPANLISGIITEKGVVTKTTAGGAFDIKAFVQKTG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo