Glyma15g19510 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g19510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g19510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g19510

Feature Type:	gene_model
Chromosome:	Gm15
Start:	16833879
stop:	16835243
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g19510

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G20630	AT	Annotation by Michelle Graham. TAIR10: germin 3 \| chr5:6975315-6975950 REVERSE LENGTH=211	SoyBase	E_val: 2.00E-100	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0010103	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis	SoyBase	N/A	ISS
GO:0018119	GO-bp	Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0031012	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0030145	GO-mf	Annotation by Michelle Graham. GO Molecular Function: manganese ion binding	SoyBase	N/A	ISS
GO:0045735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity	SoyBase	N/A	ISS
PF00190	PFAM	Cupin	JGI		ISS
UniRef100_C7S8C4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 10 n=1 Tax=Glycine max RepID=C7S8C4_SOYBN	SoyBase	E_val: 1.00E-149	ISS
UniRef100_C7S8C4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 10 n=1 Tax=Glycine max RepID=C7S8C4_SOYBN	SoyBase	E_val: 1.00E-149	ISS

Expression Patterns of Glyma15g19510

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g19510 not represented in the dataset	Glyma15g19510 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19510 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g176900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g19510

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g19510

Limit To All Plant Sequences

>Glyma15g19510.1   sequence type=CDS   gene model=Glyma15g19510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAAGATGATTCTAACCCTCTTCTTCAATATCATTTTATCTCTCCTCTCCCTCTCCCACGCCTCCGTGGTGGATTTCTGCGTAGCAGACTACACAGGCCCCAATGGCCCCGCAGGGTACTCATGCAAGAGCCCAGCAAAGGTCACGGTGGACGACTTCGTCTACTCCGGCCTTGGCACCGCCGGCAACACCTCAAACATCATCAAAGCCGCGGTGACGCCGGCGTTCGACGCGCAATTCCCCGGCGTCAACGGGCTTGGAATCTCCATTGCACGCCTAGACCTAGCAGCCGGTGGAGTCATCCCTCTTCACACGCACCCTGGTGCCTCAGAGCTGCTGGTGGTTGTGCAGGGAACAATCTGCACCGGCTTCGTTGCTTCGGACAACACTGTGTACCTCAAAACCCTAAAAAAGGGTGATGTCATGGTGTACCCTCAGGGCTTGTTGCACTTCCAGATCAACGATGGAGAGTCTCAGGCTTTGGCTTTTGTGAGCTTCAGCAGTGCTAACCCTGGCCTCCAGATTCTGGACTTTTCTTTGTTCAAGAGTGATTTCCCCACTGAGCTTATCACGCAAACCACTTTCATTGATGCTGCAGTTGTCAAGAAGCTCAAGGGTGTTCTTGGAGGGTCAGGTTAA

Predicted protein sequences of Glyma15g19510

Limit To All Plant Sequences

>Glyma15g19510.1   sequence type=predicted peptide   gene model=Glyma15g19510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKKMILTLFFNIILSLLSLSHASVVDFCVADYTGPNGPAGYSCKSPAKVTVDDFVYSGLGTAGNTSNIIKAAVTPAFDAQFPGVNGLGISIARLDLAAGGVIPLHTHPGASELLVVVQGTICTGFVASDNTVYLKTLKKGDVMVYPQGLLHFQINDGESQALAFVSFSSANPGLQILDFSLFKSDFPTELITQTTFIDAAVVKKLKGVLGGSG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain