Report for Sequence Feature Glyma15g19510
Feature Type: gene_model
Chromosome: Gm15
Start: 16833879
stop: 16835243
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g19510
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G20630 AT
Annotation by Michelle Graham. TAIR10: germin 3 | chr5:6975315-6975950 REVERSE LENGTH=211
SoyBase E_val: 2.00E-100 ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0010103 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis
SoyBase N/A ISS
GO:0018119 GO-bp
Annotation by Michelle Graham. GO Biological Process: peptidyl-cysteine S-nitrosylation
SoyBase N/A ISS
GO:0019684 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction
SoyBase N/A ISS
GO:0030003 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0070838 GO-bp
Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0009505 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall
SoyBase N/A ISS
GO:0031012 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0030145 GO-mf
Annotation by Michelle Graham. GO Molecular Function: manganese ion binding
SoyBase N/A ISS
GO:0045735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity
SoyBase N/A ISS
PF00190 PFAM
Cupin
JGI ISS
UniRef100_C7S8C4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Germin-like protein 10 n=1 Tax=Glycine max RepID=C7S8C4_SOYBN
SoyBase E_val: 1.00E-149 ISS
UniRef100_C7S8C4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Germin-like protein 10 n=1 Tax=Glycine max RepID=C7S8C4_SOYBN
SoyBase E_val: 1.00E-149 ISS
Expression Patterns of Glyma15g19510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma15g19510 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g176900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g19510
Coding sequences of Glyma15g19510
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g19510.1 sequence type=CDS gene model=Glyma15g19510 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGAAGATGATTCTAACCCTCTTCTTCAATATCATTTTATCTCTCCTCTCCCTCTCCCACGCCTCCGTGGTGGATTTCTGCGTAGCAGACTACACAGGCCCCAATGGCCCCGCAGGGTACTCATGCAAGAGCCCAGCAAAGGTCACGGTGGACGACTTCGTCTACTCCGGCCTTGGCACCGCCGGCAACACCTCAAACATCATCAAAGCCGCGGTGACGCCGGCGTTCGACGCGCAATTCCCCGGCGTCAACGGGCTTGGAATCTCCATTGCACGCCTAGACCTAGCAGCCGGTGGAGTCATCCCTCTTCACACGCACCCTGGTGCCTCAGAGCTGCTGGTGGTTGTGCAGGGAACAATCTGCACCGGCTTCGTTGCTTCGGACAACACTGTGTACCTCAAAACCCTAAAAAAGGGTGATGTCATGGTGTACCCTCAGGGCTTGTTGCACTTCCAGATCAACGATGGAGAGTCTCAGGCTTTGGCTTTTGTGAGCTTCAGCAGTGCTAACCCTGGCCTCCAGATTCTGGACTTTTCTTTGTTCAAGAGTGATTTCCCCACTGAGCTTATCACGCAAACCACTTTCATTGATGCTGCAGTTGTCAAGAAGCTCAAGGGTGTTCTTGGAGGGTCAGGTTAA
Predicted protein sequences of Glyma15g19510
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g19510.1 sequence type=predicted peptide gene model=Glyma15g19510 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKKMILTLFFNIILSLLSLSHASVVDFCVADYTGPNGPAGYSCKSPAKVTVDDFVYSGLGTAGNTSNIIKAAVTPAFDAQFPGVNGLGISIARLDLAAGGVIPLHTHPGASELLVVVQGTICTGFVASDNTVYLKTLKKGDVMVYPQGLLHFQINDGESQALAFVSFSSANPGLQILDFSLFKSDFPTELITQTTFIDAAVVKKLKGVLGGSG*