SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19505

Feature Type:gene_model
Chromosome:Gm15
Start:16829175
stop:16830471
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19505
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12150AT Annotation by Michelle Graham. TAIR10: Rho GTPase activation protein (RhoGAP) with PH domain | chr5:3924393-3930100 REVERSE LENGTH=827 SoyBaseE_val: 2.00E-19ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005543GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid binding SoyBaseN/AISS
GO:0035091GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol binding SoyBaseN/AISS
UniRef100_G7K336UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rho GTPase-activating protein n=1 Tax=Medicago truncatula RepID=G7K336_MEDTR SoyBaseE_val: 2.00E-17ISS
UniRef100_UPI000233B9E0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B9E0 related cluster n=1 Tax=unknown RepID=UPI000233B9E0 SoyBaseE_val: 7.00E-22ISS

Expression Patterns of Glyma15g19505
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g19505 not represented in the dataset
Glyma15g19505 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19505 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g19505
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19505
>Glyma15g19505.1   sequence type=CDS   gene model=Glyma15g19505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTATCCGATTCATAATTCTGAAAATGATGCATACAATTGGTTCTCATTCTCAAGAGAATAGAACGACTCCATCTGTTGTTGCTGCTTGCATGGCACCCTTGCTCTTACAACCTCTACTAGCTAGAGAATGTGAACTCGAGGATGAATTTGATGCCTGTGGTGATAGTTCGGCCCAGCTTCTTGCTTCTACTAATAATGCTCAAGCAATTATTACAACTTTGTTAGAGGAGTACGAGAATATATCTGATGTAAGAAACTCTCAATCAATTTGTATTCTTTTGATTAATTGCTTTCTGGTTTGTGTATGCTTACAATTAGGAAAAGTAACTTAA
Predicted protein sequences of Glyma15g19505
>Glyma15g19505.1   sequence type=predicted peptide   gene model=Glyma15g19505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIRFIILKMMHTIGSHSQENRTTPSVVAACMAPLLLQPLLARECELEDEFDACGDSSAQLLASTNNAQAIITTLLEEYENISDVRNSQSICILLINCFLVCVCLQLGKVT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo