Report for Sequence Feature Glyma15g19500
Feature Type: gene_model
Chromosome: Gm15
Start: 16828891
stop: 16829125
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g19500
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G06390 AT
Annotation by Michelle Graham. TAIR10: GSK3/SHAGGY-like protein kinase 1 | chr1:1946860-1950417 FORWARD LENGTH=407
SoyBase E_val: 5.00E-25 ISS
GO:0006468 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein phosphorylation
SoyBase N/A ISS
GO:0009742 GO-bp
Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway
SoyBase N/A ISS
GO:0032880 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of protein localization
SoyBase N/A ISS
GO:0042538 GO-bp
Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response
SoyBase N/A ISS
GO:0046777 GO-bp
Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation
SoyBase N/A ISS
GO:0051049 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transport
SoyBase N/A ISS
GO:0005829 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosol
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0004672 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein kinase activity
SoyBase N/A ISS
GO:0004674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity
SoyBase N/A ISS
GO:0005524 GO-mf
Annotation by Michelle Graham. GO Molecular Function: ATP binding
SoyBase N/A ISS
GO:0016301 GO-mf
Annotation by Michelle Graham. GO Molecular Function: kinase activity
SoyBase N/A ISS
GO:0016772 GO-mf
Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups
SoyBase N/A ISS
PTHR24057 Panther
GLYCOGEN SYNTHASE KINASE-3 ALPHA
JGI ISS
UniRef100_G5DXN5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Shaggy-like protein kinase (Fragment) n=1 Tax=Silene latifolia RepID=G5DXN5_SILLA
SoyBase E_val: 1.00E-23 ISS
UniRef100_I1K8R1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K8R1_SOYBN
SoyBase E_val: 9.00E-25 ISS
Expression Patterns of Glyma15g19500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma15g19500 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma15g19500
Coding sequences of Glyma15g19500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g19500.1 sequence type=CDS gene model=Glyma15g19500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
CCATTATTCCCTAGCAAAAATGCAGTAGACCAGCTTGTACATATTATAAAGGTGCTTGGCACACCCACCCAAGAGGAAGTATGTTGTATGAATCCCAATTACAATGACTTTAGGTTTCCACAGATAAAAGCACACCCATGGCACAAG
Predicted protein sequences of Glyma15g19500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g19500.1 sequence type=predicted peptide gene model=Glyma15g19500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
PLFPSKNAVDQLVHIIKVLGTPTQEEVCCMNPNYNDFRFPQIKAHPWHK