SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19490

Feature Type:gene_model
Chromosome:Gm15
Start:16810013
stop:16810530
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19490
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79660AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G16170.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr1:29976294-29976575 FORWARD LENGTH=93 SoyBaseE_val: 2.00E-24ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MHF1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHF1_SOYBN SoyBaseE_val: 1.00E-60ISS
UniRef100_Q9S9M0UniRef Annotation by Michelle Graham. Most informative UniRef hit: T24D18.25 protein n=2 Tax=Arabidopsis thaliana RepID=Q9S9M0_ARATH SoyBaseE_val: 1.00E-18ISS

Expression Patterns of Glyma15g19490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19490 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g176700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19490
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19490
>Glyma15g19490.1   sequence type=CDS   gene model=Glyma15g19490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATTGACTCCATTCTGACATCTCCTCGTCTCAAGTCTCCATCTTTCAGGAGGCAGTTTAAAAAGGATGAACTGGGTAGTTGGTCCACACTTTTCCAAAGGCATCACTTCCTCTTATCTACTCTTGTTCTGCTAACTCTCCTCTACACTATTTATCTTTACTTTGCTGTCACTTTAGGGGCTAGTGGCACCTGTTCTGGTTTGAGTGGAGCGCAGAAAGCTTCATGCCATATGGAGCTTGTTAAGGATTCTGTGGCCAAGGGTAAACTGAAAATTCTTTGA
Predicted protein sequences of Glyma15g19490
>Glyma15g19490.1   sequence type=predicted peptide   gene model=Glyma15g19490   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVIDSILTSPRLKSPSFRRQFKKDELGSWSTLFQRHHFLLSTLVLLTLLYTIYLYFAVTLGASGTCSGLSGAQKASCHMELVKDSVAKGKLKIL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo