Glyma15g19460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19460

Feature Type:	gene_model
Chromosome:	Gm15
Start:	16759912
stop:	16762499
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g19460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13960	AT	Annotation by Michelle Graham. TAIR10: growth-regulating factor 5 \| chr3:4608526-4610160 FORWARD LENGTH=397	SoyBase	E_val: 5.00E-53	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0016570	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone modification	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048449	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ formation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016818	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	SoyBase	N/A	ISS
PF08879	PFAM	WRC	JGI		ISS
PF08880	PFAM	QLQ	JGI		ISS
UniRef100_G7L6U2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GRL2 n=1 Tax=Medicago truncatula RepID=G7L6U2_MEDTR	SoyBase	E_val: 6.00E-55	ISS
UniRef100_I1MHE9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHE9_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g19460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g19460

Paralog	Evidence	Comments
Glyma09g07990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g19460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g176500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g19460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g19460

Limit To All Plant Sequences

>Glyma15g19460.1   sequence type=CDS   gene model=Glyma15g19460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAATGGAAGGAACAGGTTCCCCTTTACCCCATCACAGTGGCAAGAGCTTGAACACCAAGCTCTCATCTACAAGTACATGGCTTCAGGCATTTCCATTCCACCTGATCTTCTCTTCACCATAAAAAGGAGCTATTTTGATTCCCCTCTGTCCTCAAGGCTTTTGCCTAACCAGCCACAGCACTTTGGATGGAACTACCTTCAGATGGGTTTGGGAAGAAAAATAGACCCTGAGCCAGGTAGGTGTAGAAGAACTGATGGCAAGAAATGGAGATGCTCCAAAGAAGCATACCCAGATTCAAAGTACTGTGAGAGGCACATGCACAGAGGGAAGAATCGTTCAAGAAAGCCTGTGGAAGTTTTAAAATCAACAACAACACCATCATCATCAACAACAAACTCAAATGCTTCTTCTACACAACAAGCAATCTCATCAATCACCAAAATTAATAGCACTCTCTCACCTCTTGCATCATCTGAGACTCACCAACACCACCACTATCCTCAACACTATGGCTCCTTTCTCTATCATCATCACCCTCCTTCAAGGTCCTCTGGCATTGGCTTGTCTTTTGAAGACAACAGTGCTCCCTTGTTTCTTGACACTGGCTCATGCTCTCAGTCCAACACAGACTGCAGGAGTAGGTATGTTTATGGAGAGAAAGAGGAGGTGGATGAGCATGCTTTCTTCACAGAACCTTGTGGTGTTATGAAAAGCTTCTCTGCTTCCTCTATGGATGACTCATGGCAACTCACACCATTGACTATGAGCTCCTCATCTTCATCTTCCAAGCAGAGGAGTTCCTTTGGCTTGTCCAGTGATTACTCTTGCTTGCAACTTCAGAGCCACTCAAAGCAGCAGCAGCAAGAGCATCATCAAGATCAGGGTTGCTACATGTTTGGTGCTGGTCAAGTTGTGAAAGAAGAACCTCAGAAAACGGTTCATCGCTTCTTTGATGAATGGCCACACAAAGGAAGAGAAGGCTCTTGGCTTGATTTGGATGACAAATCTTCCACAACCCAACTTTCAATTTCCATCCCCACATCTTCTCATGATTTTTCAACTTTCAGTTCCAGAACCCACCATGATGGTTGA

Predicted protein sequences of Glyma15g19460

Limit To All Plant Sequences

>Glyma15g19460.1   sequence type=predicted peptide   gene model=Glyma15g19460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMNGRNRFPFTPSQWQELEHQALIYKYMASGISIPPDLLFTIKRSYFDSPLSSRLLPNQPQHFGWNYLQMGLGRKIDPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEVLKSTTTPSSSTTNSNASSTQQAISSITKINSTLSPLASSETHQHHHYPQHYGSFLYHHHPPSRSSGIGLSFEDNSAPLFLDTGSCSQSNTDCRSRYVYGEKEEVDEHAFFTEPCGVMKSFSASSMDDSWQLTPLTMSSSSSSSKQRSSFGLSSDYSCLQLQSHSKQQQQEHHQDQGCYMFGAGQVVKEEPQKTVHRFFDEWPHKGREGSWLDLDDKSSTTQLSISIPTSSHDFSTFSSRTHHDG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain