SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19390

Feature Type:gene_model
Chromosome:Gm15
Start:16663460
stop:16665690
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G06255AT Annotation by Michelle Graham. TAIR10: ELF4-like 3 | chr2:2459336-2459665 FORWARD LENGTH=109 SoyBaseE_val: 2.00E-44ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF07011PFAM Protein of unknown function (DUF1313) JGI ISS
UniRef100_C6T1H5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T1H5_SOYBN SoyBaseE_val: 5.00E-76ISS
UniRef100_C6ZKH2UniRef Annotation by Michelle Graham. Most informative UniRef hit: ELF4-like protein n=1 Tax=Beta vulgaris RepID=C6ZKH2_BETVU SoyBaseE_val: 2.00E-51ISS

Expression Patterns of Glyma15g19390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g176300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19390
>Glyma15g19390.1   sequence type=CDS   gene model=Glyma15g19390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTGGCTCATTCAATGGTGCTCAGATTGATGCCAAGATCATGCAGACATTTAAGAAGAACTTTGTTCAAGTGCAGGACATTTTTGATCAGAACAGGCTACTCATCAATGAGATAAACCAGAACCACGAGTCTAAGGTCCCTGATAACCTCACCAGGAATGTGGGGCTAATTAGGGAGCTCAATAACAACATCAGAAGAGTGTATGACCTATATGCCGATCTTTCGAGTTCCTTTACCAAGTCTATGGAAGTTACTTCAGAGGGAGATTCAAGTGGTGGTGCTGTGAAATCATCAGATGGGAAAGCCGGCCACAAGAGACACAGGCCTGTGTAG
Predicted protein sequences of Glyma15g19390
>Glyma15g19390.1   sequence type=predicted peptide   gene model=Glyma15g19390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGGSFNGAQIDAKIMQTFKKNFVQVQDIFDQNRLLINEINQNHESKVPDNLTRNVGLIRELNNNIRRVYDLYADLSSSFTKSMEVTSEGDSSGGAVKSSDGKAGHKRHRPV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo