SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19370

Feature Type:gene_model
Chromosome:Gm15
Start:16646832
stop:16647472
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G31670AT Annotation by Michelle Graham. TAIR10: Stress responsive alpha-beta barrel domain protein | chr2:13472699-13473490 REVERSE LENGTH=263 SoyBaseE_val: 9.00E-39ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF07876PFAM Stress responsive A/B Barrel Domain JGI ISS
UniRef100_I1MHE4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHE4_SOYBN SoyBaseE_val: 8.00E-100ISS

Expression Patterns of Glyma15g19370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g176100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19370
>Glyma15g19370.2   sequence type=CDS   gene model=Glyma15g19370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCAACGAGCCAAGGCACGGTGGTGGAACACGTCGTCCTCGTGAAGGTAAAAGACGACACGGAACCGACCAAGGTCAACGCGATGGTCAACGCCATGAACTCTTTGGCTACCATCGACGGCGTCAAGCACCTCACGGTGGGCCCACTCCTCCGCAACGGGCCCACCACCACCACCTCGGGTCTCCGTTTCACGCACATGCTCCACAACCGCTACAACTCCAAGGAAGCCCTTGAGGTTTATAACAAACACCCCAGCCACGTCAACGCCGTTAGGGATTCCTTTTTCCTCTTTTTAAAGCTGAAGGAGAGCATCTATGAGGAGGTTAAGGACGAGGCTTTGAGTGTTGTACGAGGAATGGAGCACGGTGTCGCAGGAGTTCTTTGGCAATTCTCCTACGACGAGAACTTCTCGCCGGAGAGAGCCAAGGGCTTCACGCTCGCTTCGCTCGCGGTTTTTCCTGAGCGGGAGGAGTTACAGAGTGTGGAGTTGGACGAGGGGTTGGGGGTGGTTGTGGAGGATGTGGTGGTTGTTGACTATGTGGTGCCTTAG
Predicted protein sequences of Glyma15g19370
>Glyma15g19370.2   sequence type=predicted peptide   gene model=Glyma15g19370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSTSQGTVVEHVVLVKVKDDTEPTKVNAMVNAMNSLATIDGVKHLTVGPLLRNGPTTTTSGLRFTHMLHNRYNSKEALEVYNKHPSHVNAVRDSFFLFLKLKESIYEEVKDEALSVVRGMEHGVAGVLWQFSYDENFSPERAKGFTLASLAVFPEREELQSVELDEGLGVVVEDVVVVDYVVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo