SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19110

Feature Type:gene_model
Chromosome:Gm15
Start:16158368
stop:16159537
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08450AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Histone deacetylation protein Rxt3 (InterPro:IPR013951); Has 34444 Blast hits to 20801 proteins in 1175 species: Archae - 64; Bacteria - 2390; Metazoa - 15568; Fungi - 3729; Plants - 1886; Viruses - 208; Other Eukaryotes - 10599 (source: NCBI BLink). | chr5:2727970-2732572 REVE SoyBaseE_val: 1.00E-30ISS
GO:0006486GO-bp Annotation by Michelle Graham. GO Biological Process: protein glycosylation SoyBaseN/AISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009888GO-bp Annotation by Michelle Graham. GO Biological Process: tissue development SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0010638GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of organelle organization SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7L6E8UniRef Annotation by Michelle Graham. Most informative UniRef hit: RXT3-like protein n=1 Tax=Medicago truncatula RepID=G7L6E8_MEDTR SoyBaseE_val: 1.00E-40ISS
UniRef100_UPI000233D366UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D366 related cluster n=1 Tax=unknown RepID=UPI000233D366 SoyBaseE_val: 9.00E-53ISS

Expression Patterns of Glyma15g19110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g19110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g19110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19110
>Glyma15g19110.1   sequence type=CDS   gene model=Glyma15g19110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCCAAAGACACATACCCTTTGCCTGTCATCGCAGGTTGGTCGATGGAGCGTCCGGATTCCAGGTGCTAAGCTTCCTGGACGCCTACTTCGGATACAACCAAATCAGAATGCACCCTCTAGATGAGGAGAAAACGACATTCATCACTAAAGATGTCAACTTTAGCTATGAGGTCTCAAAGCATACCTCAACATGTGGTAGACCTGGAAGAATTCTTCGGCTTCATGATTACACATCTACTCGTTTGAAAAAGGGAGAAGTTTTGTATTTGGACACATTTGTCCTGTCATTTTTCTGTAAATATGAACTTTGTTTTACTGGAGAGAAGATGGTCAAGGTTACACCAGCAACCCAGTTGCATGACCCTGCCACAGAAAAGTCTCAAAATCACCACCCACATTCTACAAATGGTGAAAAAAATGATTGTGAGAGTGTCATGATTGATGCATTCAGGTGGTCTCGTTGTAAGAAGCCTCTACCACAGAAACTGATGCATACAATTGGCATCCCTTTGCCTATTGAACATATAGAGAGTTGCAGACCAATCAGAGCTGTAGAACTCGCTAAGCACGAACCCTTTGCGCTAAGCCCAAATCCTTCTCGGGTTTTCTAA
Predicted protein sequences of Glyma15g19110
>Glyma15g19110.1   sequence type=predicted peptide   gene model=Glyma15g19110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPQRHIPFACHRRLVDGASGFQVLSFLDAYFGYNQIRMHPLDEEKTTFITKDVNFSYEVSKHTSTCGRPGRILRLHDYTSTRLKKGEVLYLDTFVLSFFCKYELCFTGEKMVKVTPATQLHDPATEKSQNHHPHSTNGEKNDCESVMIDAFRWSRCKKPLPQKLMHTIGIPLPIEHIESCRPIRAVELAKHEPFALSPNPSRVF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo