SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g19100

Feature Type:gene_model
Chromosome:Gm15
Start:16107437
stop:16108226
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g19100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G06520AT Annotation by Michelle Graham. TAIR10: photosystem II subunit X | chr2:2587868-2588218 REVERSE LENGTH=116 SoyBaseE_val: 6.00E-30ISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF06596PFAM Photosystem II reaction centre X protein (PsbX) JGI ISS
UniRef100_C1K5D2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast photosystem II subunit X n=1 Tax=Vigna radiata RepID=C1K5D2_VIGRA SoyBaseE_val: 9.00E-52ISS
UniRef100_I1MHC2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHC2_SOYBN SoyBaseE_val: 1.00E-75ISS

Expression Patterns of Glyma15g19100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g19100
ParalogEvidenceComments
Glyma09g07880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g19100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g174200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g19100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g19100
>Glyma15g19100.1   sequence type=CDS   gene model=Glyma15g19100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCACTTCTGCAGTTTCAATGGCTATGCCAGTAACTTATGCTAGCCAGAAGAGGGTGGTGCCTAGCTCGGATGCATTCTTCAAGCCACTGCCTCTACGGTCTTCCAAGGCAGTGACAGCATCAAAACTCAATGGAAGGTTTCAAGTGAGGGCCTCCATGAAGGAGAAAGTTGTGACGGGGCTCACCGCAGCTGCATTGACAGCTTCAATGATGGTTCCTGATGTGGCTGAGGCTGCCGTTACACCTTCTCTCAAGAACTTCTTGCTCAGCATCGCGGCAGGTGGAGTTGTTGTTGTTGCCATTATTGGTGCTGTGATCGGTGTTTCCAATTTCGATCCCGTCAAGCGTAGCTGA
Predicted protein sequences of Glyma15g19100
>Glyma15g19100.1   sequence type=predicted peptide   gene model=Glyma15g19100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASTSAVSMAMPVTYASQKRVVPSSDAFFKPLPLRSSKAVTASKLNGRFQVRASMKEKVVTGLTAAALTASMMVPDVAEAAVTPSLKNFLLSIAAGGVVVVAIIGAVIGVSNFDPVKRS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo