Glyma15g18970 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g18970

Feature Type:	gene_model
Chromosome:	Gm15
Start:	15866439
stop:	15875554
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g18970

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G72830	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit A3 \| chr1:27405699-27407088 REVERSE LENGTH=340	SoyBase	E_val: 1.00E-37	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016602	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR12632	Panther	TRANSCRIPTION FACTOR NF-Y ALPHA-RELATED	JGI		ISS
PTHR12632:SF5	Panther	TRANSCRIPTIONAL ACTIVATOR PHP2-RELATED	JGI		ISS
PF02045	PFAM	CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B	JGI		ISS
UniRef100_I1MHB5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MHB5_SOYBN	SoyBase	E_val: 3.00E-169	ISS
UniRef100_I3TAV3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit A3 n=1 Tax=Medicago truncatula RepID=I3TAV3_MEDTR	SoyBase	E_val: 6.00E-118	ISS

Expression Patterns of Glyma15g18970

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g18970 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g173300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g18970

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g18970

Limit To All Plant Sequences

>Glyma15g18970.1   sequence type=CDS   gene model=Glyma15g18970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCAATTTCTCTTTTTGAATCTTCCTGACACCGAGATCAATTGTTCACAAGTTGATTGCAATCACTCAATGGCTCATTCTTCTTATCCCTACGGCGATCCAATTCTTGCTTATGGACCACAAGCTATTAGTCATCCCCAAATGGTACCCCAGATGCTGGGACTAGCATCCACCAGAGTGGCATTACCACTTGATCTTGCTGAAGATGGACCGATTTATGTCAACGCGAAACAATACCATGGTATACTGAGAAGGCGACAGTCACGAGCAAAACTTGAGGCTCAGAACAAACTTATCAAAAGTCGTAAGCCATATCTTCATGAGTCTCGGCACCGCCATGCTTTGAATAGGGTTAGGGGATCTGGGGGTCGATTTCTGAGTACCAAACAGCTTGCACAGTCTAATGCAGAATTTGTCACCGGTGCACATTCTGGTTCTGACCCTACCAACATATATCAGAAAGAACATCCATTAGAGGTGGAAAGTCATTCCTCAAAAGATGGAGATAATGCATCATTCATAACAACCTACTCCGACCGGCCATGTTTATCTGGCAACAACCTCAATTTTCGGCAGCAGGAGTGCATGTTTCTGGGGAATTCTGCAAACATGAGTGGAGCACCACAGTGCAGTGGGGGACTCACCTTTGGCGGAGCAAAGCAACGCACTTCAGTTGTCCGGTGA

Predicted protein sequences of Glyma15g18970

Limit To All Plant Sequences

>Glyma15g18970.1   sequence type=predicted peptide   gene model=Glyma15g18970   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKQFLFLNLPDTEINCSQVDCNHSMAHSSYPYGDPILAYGPQAISHPQMVPQMLGLASTRVALPLDLAEDGPIYVNAKQYHGILRRRQSRAKLEAQNKLIKSRKPYLHESRHRHALNRVRGSGGRFLSTKQLAQSNAEFVTGAHSGSDPTNIYQKEHPLEVESHSSKDGDNASFITTYSDRPCLSGNNLNFRQQECMFLGNSANMSGAPQCSGGLTFGGAKQRTSVVR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain