SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g18800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g18800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g18800

Feature Type:gene_model
Chromosome:Gm15
Start:15684198
stop:15686003
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g18800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26100AT Annotation by Michelle Graham. TAIR10: casein kinase 1 | chr4:13227885-13230508 REVERSE LENGTH=450 SoyBaseE_val: 3.00E-61ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR11909Panther CASEIN KINASE-RELATED JGI ISS
PTHR11909:SF18Panther CASEIN KINASE JGI ISS
UniRef100_G7IS37UniRef Annotation by Michelle Graham. Most informative UniRef hit: Casein kinase I isoform delta-like protein n=1 Tax=Medicago truncatula RepID=G7IS37_MEDTR SoyBaseE_val: 8.00E-60ISS
UniRef100_UPI00023389B9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023389B9 related cluster n=1 Tax=unknown RepID=UPI00023389B9 SoyBaseE_val: 2.00E-60ISS

Expression Patterns of Glyma15g18800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g18800 not represented in the dataset
Glyma15g18800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g18800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g18800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g18800
>Glyma15g18800.1   sequence type=CDS   gene model=Glyma15g18800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAAAAGATATAGGGACCCTAACACAAACAAACATATTCCTAACATTGGTACTTTTTTTCTTCTTTCTTCATTTTTCTTGTTCAAAATTTGTATGGTTAAAATTTGGTAATCATTTTTACATCAAGCGAGACAACTTCCTCATGGGTTTAGGGAGGCGTGCAAATCAAAGGTATATCATTGACTTTGGCCTTGCTAAGAAATATAAAGACACCACTACACATCAGCATATTCCTTACAGCAGCTTCAAAATTTATAACAAGAATTTGACTGGAACGGCTAGGTATGCTAGTATGAATACTCATCTAGGAATTGTCACTTGGATACATTCTTATGTACTTTTTAAGAGGAAGTTCTACCATCTAACTTGGCAGGGATTGAAAGTCGATACTAAGAAGAAGAAGTATGAGGAGATTAGTGAGAAGAAAGATTTTACTTCTATTAAGTCTCTTCGTCGTGGCTATCCCTCAAAACTTGCTTCATACTTTCATTATTGTCGATCACTGAGGTTTGATGATAAACCAAAATATGCTTATTTGAAAAGACATTTCTGTTTAGTAGTTTCAACATCGATTCAAAACTGA
Predicted protein sequences of Glyma15g18800
>Glyma15g18800.1   sequence type=predicted peptide   gene model=Glyma15g18800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QKDIGTLTQTNIFLTLVLFFFFLHFSCSKFVWLKFGNHFYIKRDNFLMGLGRRANQRYIIDFGLAKKYKDTTTHQHIPYSSFKIYNKNLTGTARYASMNTHLGIVTWIHSYVLFKRKFYHLTWQGLKVDTKKKKYEEISEKKDFTSIKSLRRGYPSKLASYFHYCRSLRFDDKPKYAYLKRHFCLVVSTSIQN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo