Report for Sequence Feature Glyma15g18360
Feature Type: gene_model
Chromosome: Gm15
Start: 15098520
stop: 15100868
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g18360
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G25810 AT
Annotation by Michelle Graham. TAIR10: xyloglucan endotransglycosylase 6 | chr4:13128694-13129715 FORWARD LENGTH=286
SoyBase E_val: 3.00E-141 ISS
GO:0005975 GO-bp
Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process
SoyBase N/A ISS
GO:0006073 GO-bp
Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0004553 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds
SoyBase N/A ISS
GO:0016762 GO-mf
Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity
SoyBase N/A ISS
GO:0016798 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds
SoyBase N/A ISS
PTHR10963 Panther
SECRETED GLUCOSIDASE-RELATED
JGI ISS
PTHR10963:SF14 Panther
BETA-GLUCANASE
JGI ISS
PF00722 PFAM
Glycosyl hydrolases family 16
JGI ISS
PF06955 PFAM
Xyloglucan endo-transglycosylase (XET) C-terminus
JGI ISS
UniRef100_A1E368 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglycosylase n=1 Tax=Musa acuminata RepID=A1E368_MUSAC
SoyBase E_val: 2.00E-148 ISS
UniRef100_I1MH66 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MH66_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma15g18360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g18360
Paralog Evidence Comments
Glyma09g07070 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g18360 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g169100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g18360
Coding sequences of Glyma15g18360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g18360.1 sequence type=CDS gene model=Glyma15g18360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCACCTTAGTCTTCACCAAAATACTCCTCTTGGCATCTTGTGTTGTGTCCCTCTTTTAAGCTATTTCCTTCTCTTAACACAATTGGTTGTGCCAATTGCCATAGTCACCAACCAATTAACAAAGGTATATATATCATCATATCATCACCAAATGAAAAATATTGGGTTGTTTTTTCTTGTGGTGGTGGCTACTTTTGTGGTGGCAGCCACAGCTGGTAGCTTTTACCAAGACTTTGAAATAACGTGGGGTGGTGAGCGTGCCAAAATCTATGAGAATGGAAACCTTCTCACACTCTCCCTTGACAGAGCCTCTGGCTCTGGCTTTCGTTCCAAAAAAGAGTACTTGTTCGGAAAAATTGACATGCAGCTCAAGCTTGTGCCTGGTAACTCTGCTGGAACAGTAACTGCCTATTATTTATCTTCTCTGGGGCCTACTCATGACGAAATAGACTTTGAGTTTTTGGGTAACTTGAGTGGTGATCCTTACACTCTCCACACGAACGTATTCAGCCAAGGGAAAGGGAACAGAGAACAACAGTTCCATCTATGGTTCGACCCCACCAAGGACTTCCACACATACTCCGTCCAATGGAATCCTGCAAGCATCATATTCTCTGTTGACGGGACCCCAATAAGGGAGTTCAAGAATTTGGAGACAAAAGGGGTTCCATTCCCAAAGAGCCAACCCATGAGAATATACTCTAGTCTTTGGAACGCTGAGGATTGGGCCACAAGGGGTGGGCTTGTGAAAACGGATTGGAGCAAGGCCCCATTCACAGCCTCTTACAGAAACTTCAATTCCCAAACCTCTTCCTCCACTGGCCAATCACTGGACGCCACGGGGCAGGCAAAGATCCGTTGGGTGCAAAAGAATTACATGATTTACAATTATTGCACTGATATCAGACGTTTCCCTCAAGGCCTTCCTCCAGAATGCTCCATTGCATGA
Predicted protein sequences of Glyma15g18360
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g18360.1 sequence type=predicted peptide gene model=Glyma15g18360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MHLSLHQNTPLGILCCVPLLSYFLLLTQLVVPIAIVTNQLTKVYISSYHHQMKNIGLFFLVVVATFVVAATAGSFYQDFEITWGGERAKIYENGNLLTLSLDRASGSGFRSKKEYLFGKIDMQLKLVPGNSAGTVTAYYLSSLGPTHDEIDFEFLGNLSGDPYTLHTNVFSQGKGNREQQFHLWFDPTKDFHTYSVQWNPASIIFSVDGTPIREFKNLETKGVPFPKSQPMRIYSSLWNAEDWATRGGLVKTDWSKAPFTASYRNFNSQTSSSTGQSLDATGQAKIRWVQKNYMIYNYCTDIRRFPQGLPPECSIA*